Property Summary

NCBI Gene PubMed Count 242
PubMed Score 0.00
PubTator Score 4524.25

Knowledge Summary

Patent

No data available

Synonym

Accession P16442 B0JDB9 O14758 Q14490 Q53I57 Q6ISD4 Q6KFZ2 Q70V27 Q99484 Q99485 Q9NY01 Q9UQ68 Q9UQ69
Symbols GTB
NAGAT
A3GALNT
A3GALT1

Gene

ABO

PANTHER Protein Class (2)

PDB

1LZ0   1LZ7   1LZI   1LZJ   1R7T   1R7U   1R7V   1R7X   1R7Y   1R80   1R81   1R82   1WSZ   1WT0   1WT1   1WT2   1WT3   1XZ6   1ZHJ   1ZI1   1ZI3   1ZI4   1ZI5   1ZIZ   1ZJ0   1ZJ1   1ZJ2   1ZJ3   1ZJO   1ZJP   2A8U   2A8W   2I7B   2O1F   2O1G   2O1H   2PGV   2PGY   2RIT   2RIX   2RIY   2RIZ   2RJ0   2RJ1   2RJ4   2RJ5   2RJ6   2RJ7   2RJ8   2RJ9   2Y7A   3I0C   3I0D   3I0E   3I0F   3I0G   3I0H   3I0I   3I0J   3I0K   3I0L   3IOH   3IOI   3IOJ   3SX3   3SX5   3SX7   3SX8   3SXA   3SXB   3SXC   3SXD   3SXE   3SXG   3U0X   3U0Y   3V0L   3V0M   3V0N   3V0O   3V0P   3V0Q   3ZGF   3ZGG   4C2S   4FQW   4FRA   4FRB   4FRD   4FRE   4FRH   4FRL   4FRM   4FRO   4FRP   4FRQ   4GBP   4KC1   4KC2   4KC4   4KXO   4Y62   4Y63   4Y64   5BXC   5C1G   5C1H   5C1L   5C36   5C38   5C3A   5C3B   5C3D   5C47   5C48   5C49   5C4B   5C4C   5C4D   5C4E   5C4F   5C8R   5CMF   5CMG   5CMH   5CMI   5CMJ   5CQL   5CQM   5CQN   5CQO   5CQP   5TJK   5TJL   5TJN   5TJO  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (162)

AA Sequence

MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV      1 - 70
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKH     71 - 140
FMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCV    141 - 210
DVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRL    211 - 280
TRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQA    281 - 350
VRNP                                                                      351 - 354
//

Text Mined References (248)

PMID Year Title