Property Summary

NCBI Gene PubMed Count 236
PubMed Score 0.00
PubTator Score 4524.25

Knowledge Summary

Patent

No data available

Synonym

Accession P16442 B0JDB9 O14758 Q14490 Q53I57 Q6ISD4 Q6KFZ2 Q70V27 Q99484 Q99485 Q9NY01 Q9UQ68 Q9UQ69
Symbols GTB
NAGAT
A3GALNT
A3GALT1

Gene

ABO

PANTHER Protein Class (2)

PDB

1LZ0   1LZ7   1LZI   1LZJ   1R7T   1R7U   1R7V   1R7X   1R7Y   1R80   1R81   1R82   1WSZ   1WT0   1WT1   1WT2   1WT3   1XZ6   1ZHJ   1ZI1   1ZI3   1ZI4   1ZI5   1ZIZ   1ZJ0   1ZJ1   1ZJ2   1ZJ3   1ZJO   1ZJP   2A8U   2A8W   2I7B   2O1F   2O1G   2O1H   2PGV   2PGY   2RIT   2RIX   2RIY   2RIZ   2RJ0   2RJ1   2RJ4   2RJ5   2RJ6   2RJ7   2RJ8   2RJ9   2Y7A   3I0C   3I0D   3I0E   3I0F   3I0G   3I0H   3I0I   3I0J   3I0K   3I0L   3IOH   3IOI   3IOJ   3SX3   3SX5   3SX7   3SX8   3SXA   3SXB   3SXC   3SXD   3SXE   3SXG   3U0X   3U0Y   3V0L   3V0M   3V0N   3V0O   3V0P   3V0Q   3ZGF   3ZGG   4C2S   4FQW   4FRA   4FRB   4FRD   4FRE   4FRH   4FRL   4FRM   4FRO   4FRP   4FRQ   4GBP   4KC1   4KC2   4KC4   4KXO   4Y62   4Y63   4Y64   5BXC   5C1G   5C1H   5C1L   5C36   5C38   5C3A   5C3B   5C3D   5C47   5C48   5C49   5C4B   5C4C   5C4D   5C4E   5C4F   5C8R   5CMF   5CMG   5CMH   5CMI   5CMJ  

Gene RIF (156)

PMID Text
26632894 AQP1 and ABO variants appear to predict hemoglobin and hematocrit levels but not other erythrocyte phenotype parameters including red blood cell counts and red blood cell indices
26512559 Non-O blood type is associated with future cardiovascular events in Chinese Han patients undergoing coronary angiography.
26329815 High Blood type A, is associated with recurrence in bladder cancer among patients undergoing radical cystectomy.
26268879 ABO blood type was not associated with risk of aggressive prostate cancer.
26247473 An association between blood type O and the occurrence of neuroendocrine tumors in MEN1 patients was not confirmed.
26244499 We validated a strong influence of ABO blood type on von Willebrand Factor levels, but also detected a direct ABO influence on FVIII activity and FVIII/VWF ratio after adjustment for VWF.
26148378 The FII G19911A and FII C20068T are potentially associated with an increased risk for the occurrence of isolated pulmonary embolism
25854361 Blood group A and genotype AA showed the highest risks of hepatocellular carcinoma.
25820620 Data suggest women with blood groups A, B, O (i.e. non-AB) exhibit increased risk for gestational diabetes mellitus (GDM) compared with those with blood group AB; thus, glycosylation of the H antigen via NAGAT may be risk/protective factor for GDM.
25814649 No association was found between FUT2 and ABO single nucleotide polymorphism (SNPs) and chronic pancreatitis.
More...

AA Sequence

MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV      1 - 70
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKH     71 - 140
FMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCV    141 - 210
DVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRL    211 - 280
TRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQA    281 - 350
VRNP                                                                      351 - 354
//

Text Mined References (242)

PMID Year Title
26632894 2015 Association of ABO and Colton Blood Group Gene Polymorphisms With Hematological Traits Variation.
26512559 2015 Risk Factors, Coronary Severity, Outcome and ABO Blood Group: A Large Chinese Han Cohort Study.
26329815 2016 The association of ABO blood type with disease recurrence and mortality among patients with urothelial carcinoma of the bladder undergoing radical cystectomy.
26268879 2015 ABO blood group alleles and prostate cancer risk: Results from the breast and prostate cancer cohort consortium (BPC3).
26247473 2015 No Association of Blood Type O With Neuroendocrine Tumors in Multiple Endocrine Neoplasia Type 1.
26244499 2015 Quantitative Influence of ABO Blood Groups on Factor VIII and Its Ratio to von Willebrand Factor, Novel Observations from an ARIC Study of 11,673 Subjects.
26148378 2015 Prothrombin 3'end gene variants in isolated pulmonary embolism--the first report of FIIc.*64_*66del and FIIc.*303T>C variants.
25854361 2015 Association between ABO genotype and risk of hepatocellular carcinoma in Koreans.
25820620 2015 Blood group AB is protective factor for gestational diabetes mellitus: a prospective population-based study in Tianjin, China.
25814649 2016 Genetic variants of lipase activity in chronic pancreatitis.
More...