Property Summary

NCBI Gene PubMed Count 186
PubMed Score 601.63
PubTator Score 355.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.859 2.4
Disease Target Count Z-score Confidence
Saethre-Chotzen syndrome 7 3.379 1.7
Disease Target Count
Agammaglobulinemia, non-Bruton type 8

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.300 2.8e-04
astrocytic glioma 1.300 3.3e-02
atypical teratoid / rhabdoid tumor 1.700 2.6e-05
colon cancer 1.100 1.1e-04
ductal carcinoma in situ 1.100 9.7e-05
ependymoma 1.300 3.5e-07
glioblastoma 1.500 1.4e-07
group 3 medulloblastoma 1.700 3.2e-04
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
lung adenocarcinoma 1.200 2.0e-09
lung cancer 1.600 5.0e-04
malignant mesothelioma 1.100 3.8e-06
medulloblastoma, large-cell 2.200 6.0e-06
non-small cell lung cancer 1.072 8.4e-22
oligodendroglioma 1.700 1.1e-02
osteosarcoma -3.014 8.7e-07
ovarian cancer 2.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... 1.146 3.7e-02
primitive neuroectodermal tumor 1.700 8.8e-06
psoriasis -1.700 1.8e-04
subependymal giant cell astrocytoma 1.288 1.7e-02
tuberculosis 1.100 6.0e-06

Gene RIF (94)

AA Sequence

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFD      1 - 70
PSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSP     71 - 140
SGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTY    141 - 210
PAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHG    211 - 280
AEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS    281 - 350
SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP    351 - 420
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA    421 - 490
TAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERL    491 - 560
RVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVV    561 - 630
GDPQMVLSAPHPGLSEAHNPAGHM                                                  631 - 654
//

Text Mined References (200)

PMID Year Title