Property Summary

NCBI Gene PubMed Count 178
Grant Count 386
R01 Count 257
Funding $44,071,266.77
PubMed Score 577.87
PubTator Score 355.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15923 P15883 Q14208 Q14635 Q14636 Q2TB39 Q2TB40 Q9UPI9
Symbols E2A
E47
AGM8
ITF1
VDIR
TCF-3
bHLHb21

Gene

PDB

2YPA   2MH0   1HLH   2YPB   3U5V  

Gene RIF (87)

PMID Text
26942192 Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages.
26237075 We observed significant enrichment of the neuroactive ligand-receptor interaction pathway in TCF3-PBX1 as well as an enrichment of genes involved in immunity and infection pathways in ETV6-RUNX1 subtype
26223652 Data show that microRNAs miR-155 and miR-16 downregulate activation-induced cytidine deaminase (AID) and transcription factor E47 in B Cells through binding of the 3'-untranslated regions.
26214592 Drug response profiling of matched patient-derived xenografts revealed a distinct profile for TCF3-HLF ALL with resistance to conventional chemotherapeutics but sensitivity to glucocorticoids.
26212009 E47 is a novel substrate of PAK5, and PAK5-mediated phosphorylation of E47 promotes epithelial-mesenchymal transition. High expression of phospho-E47 was associated with an aggressive phenotype of colon cancer and metastasis.
25894862 Over expression of E47 reprograms human pancreatic cancer cells to a quiescent acinar state with reduced tumorigenic potential.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25659031 These results indicate that a dynamic interplay of TCF transcription factors governs MYC gene expression in colorectal cancers.
25615280 our data suggest a collaborative action between autophagy and ubiquitination in the degradation of E2A/Pbx1, thereby revealing a novel strategy for targeted preventive or treatment therapy on the pediatric ALL.
25551271 When intensive chemotherapy was used, the TCF3-PBX1 was associated with a favorable outcome in childhood pre-B ALL.
More...

AA Sequence

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFD      1 - 70
PSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSP     71 - 140
SGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTY    141 - 210
PAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHG    211 - 280
AEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS    281 - 350
SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP    351 - 420
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA    421 - 490
TAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERL    491 - 560
RVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVV    561 - 630
GDPQMVLSAPHPGLSEAHNPAGHM                                                  631 - 654
//

Text Mined References (191)

PMID Year Title
26942192 2016 E2A Antagonizes PU.1 Activity through Inhibition of DNA Binding.
26237075 2015 Epigenetic landscape correlates with genetic subtype but does not predict outcome in childhood acute lymphoblastic leukemia.
26223652 2015 MicroRNAs miR-155 and miR-16 Decrease AID and E47 in B Cells from Elderly Individuals.
26214592 2015 Genomics and drug profiling of fatal TCF3-HLF-positive acute lymphoblastic leukemia identifies recurrent mutation patterns and therapeutic options.
26212009 2016 PAK5-mediated E47 phosphorylation promotes epithelial-mesenchymal transition and metastasis of colon cancer.
25894862 2015 The basic helix-loop-helix transcription factor E47 reprograms human pancreatic cancer cells to a quiescent acinar state with reduced tumorigenic potential.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25659031 2015 A dynamic exchange of TCF3 and TCF4 transcription factors controls MYC expression in colorectal cancer cells.
25615280 2015 Autophagy collaborates with ubiquitination to downregulate oncoprotein E2A/Pbx1 in B-cell acute lymphoblastic leukemia.
More...