Property Summary

NCBI Gene PubMed Count 37
PubMed Score 241.12
PubTator Score 172.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Duane Retraction Syndrome, Type 2 1
Disease Target Count P-value
pilocytic astrocytoma 3086 9.69870945604958E-9
malignant mesothelioma 3163 6.33714461786194E-8
group 4 medulloblastoma 1875 1.08869279207314E-6
Breast cancer 3099 4.08390928211716E-6
pediatric high grade glioma 2712 6.71882472607003E-6
atypical teratoid / rhabdoid tumor 4369 1.04227432993669E-5
primitive neuroectodermal tumor 3031 2.97842117697856E-5
glioblastoma 5572 7.38680957258427E-5
primary Sjogren syndrome 789 1.93993246278026E-4
nasopharyngeal carcinoma 1056 3.37461989647869E-4
ovarian cancer 8492 3.64093650985778E-4
pituitary cancer 1972 3.90808592831193E-4
osteosarcoma 7933 4.88029452137511E-4
cutaneous lupus erythematosus 1056 5.20268826886139E-4
astrocytoma 1493 6.60291601679311E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.04989377399455E-4
ependymoma 2514 9.86564696245271E-4
lung cancer 4473 0.00133921313529106
ulcerative colitis 2087 0.00176333957789496
medulloblastoma, large-cell 6234 0.0034997436459153
psoriasis 6685 0.00366555172563634
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00626948814736806
oligodendroglioma 2849 0.0119911559079973
Pick disease 1893 0.0334443347168442
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0480328887154035

Expression

  Differential Expression (25)

Synonym

Accession P15882 A8K1M6 B3KNU6 B4DV19 Q53SD6 Q53SH5 Q96FB0
Symbols NC
CHN
DURS2
ARHGAP2
RHOGAP2

Gene

PANTHER Protein Class (2)

PDB

2OSA   3CXL  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

 GWAS Trait (1)

Gene RIF (21)

PMID Text
25676811 reduced alpha1-chimaerin expression in the brain of Alzheimer's disease cases, suggesting a role in the upregulation of Rac1 activity during the disease process.
25331612 The patients most similar belong to families with a small or absent cranial nerve VI and septo-optic hypoplasia who carry CHN1 mutations
25127029 Stimulation of mesenchymal stromal cells (MSCs) by chemerin increases phosphorylation of p42/44, p38 and JNK-II kinases and inhibitors of these kinases and PKC reverse chemerin-stimulated MSC migration.
24727542 elevated levels in colons from ulcerative colitis patients correlate with disease severity
24390241 cathepsin S and chemerin only correlated positively with insulin resistance and inflammation
24338392 Plasma chemerin levels are correlated with obesity, blood pressure, and high-density lipoprotein cholesterol, suggesting that it may play a role in the pathogenesis of metabolic syndrome.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein chimerin 1 (CHN1) in cells
21715684 Cathepsin L- and K-cleaved chemerin trigger robust migration of human blood-derived plasmacytoid dendritic cells ex vivo
21715346 Analysis of the current pedigree expands the phenotypic spectrum of hyperactivating CHN1 mutations to include vertical strabismus and supraduction deficits in the absence of Duane retraction syndrome.
21555619 Members of families segregating Duane retraction syndrome (DRS) as an autosomal dominant trait should be screened for mutations in the CHN1 gene, enhancing genetic counseling and permitting earlier diagnosis.
More...

AA Sequence

MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY      1 - 70
LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN     71 - 140
PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV    141 - 210
HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK    211 - 280
RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL    281 - 350
PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI    351 - 420
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF                                   421 - 459
//

Text Mined References (38)

PMID Year Title
25676811 2015 Alpha1-chimaerin, a Rac1 GTPase-activating protein, is expressed at reduced mRNA levels in the brain of Alzheimer's disease patients.
25416956 2014 A proteome-scale map of the human interactome network.
25331612 2015 Absence of CHN1 in two patients with a bilateral absence of cranial nerves IV and VI.
25127029 2014 Increased expression of chemerin in squamous esophageal cancer myofibroblasts and role in recruitment of mesenchymal stromal cells.
24727542 2014 Chemerin aggravates DSS-induced colitis by suppressing M2 macrophage polarization.
24390241 2014 Serum lipocalin-2, cathepsin S and chemerin levels and nonalcoholic fatty liver disease.
24338392 2013 Plasma chemerin level in metabolic syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21715684 2011 Regulation of chemerin chemoattractant and antibacterial activity by human cysteine cathepsins.
21715346 2011 Expansion of the CHN1 strabismus phenotype.
More...