Property Summary

NCBI Gene PubMed Count 37
Grant Count 43
R01 Count 39
Funding $3,856,146.94
PubMed Score 241.12
PubTator Score 172.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

 GWAS Trait (1)

Gene RIF (21)

PMID Text
25676811 reduced alpha1-chimaerin expression in the brain of Alzheimer's disease cases, suggesting a role in the upregulation of Rac1 activity during the disease process.
25331612 The patients most similar belong to families with a small or absent cranial nerve VI and septo-optic hypoplasia who carry CHN1 mutations
25127029 Stimulation of mesenchymal stromal cells (MSCs) by chemerin increases phosphorylation of p42/44, p38 and JNK-II kinases and inhibitors of these kinases and PKC reverse chemerin-stimulated MSC migration.
24727542 elevated levels in colons from ulcerative colitis patients correlate with disease severity
24390241 cathepsin S and chemerin only correlated positively with insulin resistance and inflammation
24338392 Plasma chemerin levels are correlated with obesity, blood pressure, and high-density lipoprotein cholesterol, suggesting that it may play a role in the pathogenesis of metabolic syndrome.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein chimerin 1 (CHN1) in cells
21715684 Cathepsin L- and K-cleaved chemerin trigger robust migration of human blood-derived plasmacytoid dendritic cells ex vivo
21715346 Analysis of the current pedigree expands the phenotypic spectrum of hyperactivating CHN1 mutations to include vertical strabismus and supraduction deficits in the absence of Duane retraction syndrome.
21555619 Members of families segregating Duane retraction syndrome (DRS) as an autosomal dominant trait should be screened for mutations in the CHN1 gene, enhancing genetic counseling and permitting earlier diagnosis.
More...

AA Sequence

MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY      1 - 70
LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN     71 - 140
PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV    141 - 210
HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK    211 - 280
RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL    281 - 350
PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI    351 - 420
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF                                   421 - 459
//

Text Mined References (38)

PMID Year Title
25676811 2015 Alpha1-chimaerin, a Rac1 GTPase-activating protein, is expressed at reduced mRNA levels in the brain of Alzheimer's disease patients.
25416956 2014 A proteome-scale map of the human interactome network.
25331612 2015 Absence of CHN1 in two patients with a bilateral absence of cranial nerves IV and VI.
25127029 2014 Increased expression of chemerin in squamous esophageal cancer myofibroblasts and role in recruitment of mesenchymal stromal cells.
24727542 2014 Chemerin aggravates DSS-induced colitis by suppressing M2 macrophage polarization.
24390241 2014 Serum lipocalin-2, cathepsin S and chemerin levels and nonalcoholic fatty liver disease.
24338392 2013 Plasma chemerin level in metabolic syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21715684 2011 Regulation of chemerin chemoattractant and antibacterial activity by human cysteine cathepsins.
21715346 2011 Expansion of the CHN1 strabismus phenotype.
More...