Property Summary

NCBI Gene PubMed Count 36
PubMed Score 255.80
PubTator Score 172.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Duane Retraction Syndrome 13 0.0 5.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Duane Retraction Syndrome 2 1

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.100 8.6e-04
astrocytic glioma -2.800 3.1e-03
Astrocytoma, Pilocytic -2.600 8.8e-09
atypical teratoid / rhabdoid tumor -3.300 1.0e-05
Breast cancer 1.100 3.3e-02
cutaneous lupus erythematosus 1.900 5.2e-04
ependymoma -2.900 9.9e-04
glioblastoma -2.100 2.4e-07
group 3 medulloblastoma -2.600 1.1e-03
intraductal papillary-mucinous adenoma (... -2.300 7.0e-04
intraductal papillary-mucinous carcinoma... -2.000 6.3e-03
intraductal papillary-mucinous neoplasm ... -1.800 4.8e-02
lung cancer 1.100 1.3e-03
malignant mesothelioma -1.800 6.3e-08
medulloblastoma, large-cell -2.400 3.5e-03
nasopharyngeal carcinoma 1.400 3.4e-04
oligodendroglioma -2.200 1.2e-02
osteosarcoma 2.686 4.9e-04
ovarian cancer -1.100 1.4e-02
Pick disease -1.100 3.3e-02
pituitary cancer 1.200 3.9e-04
primary Sjogren syndrome 1.600 1.9e-04
primitive neuroectodermal tumor -2.400 3.0e-05
psoriasis 1.400 3.7e-03
ulcerative colitis 1.600 1.8e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY      1 - 70
LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN     71 - 140
PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV    141 - 210
HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK    211 - 280
RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL    281 - 350
PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI    351 - 420
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF                                   421 - 459
//

Text Mined References (37)

PMID Year Title