Property Summary

NCBI Gene PubMed Count 154
Grant Count 782
R01 Count 469
Funding $130,112,589.6
PubMed Score 1445.11
PubTator Score 662.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
osteosarcoma -2.905 0.000
chronic lymphosyte leukemia -1.100 0.000
tuberculosis 2.300 0.000
active Crohn's disease -1.380 0.038
interstitial cystitis 1.900 0.000
primary Sjogren syndrome 1.700 0.000
nasopharyngeal carcinoma -1.200 0.001

Synonym

Accession P15813 D3DVD5 Q5W0J3 Q9UMM3 Q9Y5M4
Symbols R3
CD1A
R3G1

Gene

PDB

4LHU   1ZT4   2PO6   3HUJ   3SDX   3TZV   3U0P   3VWJ   3VWK   4EN3   4MNG   4MQ7   4WO4   4WW2   4WWK  

Gene RIF (152)

PMID Text
26969612 Data suggest that CD1d antigen-restricted B lymphocytes (Bc) presentation of NGcGM3 drives effective invariant natural killer T cells (iNKT) activation.
26798067 the spatiotemporal distribution of CD1d molecules on the surface of antigen-presenting cells (APCs) modulates activation of Invariant natural killer T cells.
26260288 by controlling a fundamental step in CD1d-mediated lipid antigen presentation, STAT3 signalling promotes innate immune responses driven by CD1d
26119195 both membrane-bound (V4) and soluble (V5) isoforms of CD1d were over-expressed in gastric tumor tissues, suggesting that they are involved in anti-tumor immune responses.
26116899 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
26041373 This suggests that CD1D is more polymorphic than previously assumed
25929465 our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cells
25878107 Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression.
25872908 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
25872908 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
More...

AA Sequence

MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKP      1 - 70
WSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKD     71 - 140
ILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLS    141 - 210
RGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR    211 - 280
VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL                   281 - 335
//

Text Mined References (156)

PMID Year Title
26969612 2016 The tumor antigen N-glycolyl-GM3 is a human CD1d ligand capable of mediating B cell and natural killer T cell interaction.
26798067 2016 The actin cytoskeleton modulates the activation of iNKT cells by segregating CD1d nanoclusters on antigen-presenting cells.
26260288 2015 STAT3 promotes CD1d-mediated lipid antigen presentation by regulating a critical gene in glycosphingolipid biosynthesis.
26119195 2015 Increased Expression of Two Alternative Spliced Variants of CD1d Molecule in Human Gastric Cancer.
26041373 2015 Increased CD1D polymorphism: identification of two novel alleles, CD1D*03 and *04, in individuals from Morocco.
25929465 2015 TLR9-induced miR-155 and Ets-1 decrease expression of CD1d on B cells in SLE.
25878107 2015 Herpes Simplex Virus 1 US3 Phosphorylates Cellular KIF3A To Downregulate CD1d Expression.
25649790 2015 Characterization of the interaction of staphylococcal enterotoxin B with CD1d expressed in human renal proximal tubule epithelial cells.
25618030 2015 CD1d serves as a surface receptor for oxidized cholesterol induction of peroxisome proliferator-activated receptor-?.
25477528 2015 CD1d expression in renal cell carcinoma is associated with higher relapse rates, poorer cancer-specific and overall survival.
More...