Property Summary

NCBI Gene PubMed Count 161
PubMed Score 1522.13
PubTator Score 662.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.380 3.8e-02
Astrocytoma, Pilocytic 1.100 8.8e-04
chronic lymphosyte leukemia -1.100 6.1e-05
interstitial cystitis 1.700 7.0e-04
malignant mesothelioma -1.900 4.5e-07
nasopharyngeal carcinoma -1.200 6.4e-04
osteosarcoma -2.905 4.5e-05
primary Sjogren syndrome 1.700 4.3e-04
tuberculosis 2.300 1.9e-04

 CSPA Cell Line (1)

Protein-protein Interaction (2)

Gene RIF (146)

AA Sequence

MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKP      1 - 70
WSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKD     71 - 140
ILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLS    141 - 210
RGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR    211 - 280
VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL                   281 - 335
//

Text Mined References (163)

PMID Year Title