Property Summary

NCBI Gene PubMed Count 22
Grant Count 22
R01 Count 4
Funding $3,029,089.08
PubMed Score 58.81
PubTator Score 92.66

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (8)

PMID Text
26824896 Histatin-1 is specifically expressed in human lacrimal epithelium.
23001880 We investigated interactions among and functions of histatin 1 and the other proteins that are present in saliva by using high-throughput mass spectrometric techniques. This led to the identification of 43 proteins able to interact with histatin 1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19060311 These findings indicate that the regulation of the histatin gene expression may be intricate, and it seems to have a cell-type preference in the salivary gland cells.
18650243 histatin 1 (Hst1) and histatin 2 (Hst2) as major wound-closing factors in human saliva
17503797 The results allowed locating sulfation on the last four tyrosines (Tyr 27, 30, 34, and 36).
12060866 inhibits calcium phosphate precipitation
2303595 Histatins are salivary proteins with antimicrobial activity.

AA Sequence

MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN                   1 - 57
//

Text Mined References (23)

PMID Year Title
26824896 2016 Histatin-1 Expression in Human Lacrimal Epithelium.
23001880 2012 Identification and characterization of histatin 1 salivary complexes by using mass spectrometry.
20973643 2010 Salivary peptidomics.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19060311 2009 Transcriptional regulation of the salivary histatin gene: finding of a strong positive regulatory element and its binding protein.
18650243 2008 Histatins are the major wound-closure stimulating factors in human saliva as identified in a cell culture assay.
17503797 2007 Tyrosine polysulfation of human salivary histatin 1. A post-translational modification specific of the submandibular gland.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12832472 2003 MAQ1 and 7SK RNA interact with CDK9/cyclin T complexes in a transcription-dependent manner.
More...