Property Summary

NCBI Gene PubMed Count 24
PubMed Score 62.68
PubTator Score 92.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count P-value
medulloblastoma, large-cell 6241 9.9e-04
Disease Target Count Z-score Confidence
Hypertension 396 4.018 2.0
Dental caries 164 3.67 1.8
Atypical autism 26 3.14 1.6

Gene RIF (10)

AA Sequence

MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN                   1 - 57
//

Text Mined References (25)

PMID Year Title