Property Summary

NCBI Gene PubMed Count 199
PubMed Score 441.68
PubTator Score 314.80

Knowledge Summary

Patent (12,014)

Expression

Gene RIF (169)

AA Sequence

MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKK      1 - 70
LEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP                71 - 129
//

Text Mined References (197)

PMID Year Title