Property Summary

NCBI Gene PubMed Count 190
Grant Count 128
R01 Count 83
Funding $21,858,722.52
PubMed Score 407.36
PubTator Score 314.80

Knowledge Summary

Patent (12,014)

Expression

Synonym

Accession P15382 A5H1P2 Q8N709 Q91Z94
Symbols ISK
JLNS
LQT5
MinK
JLNS2
LQT2/5

Gene

PDB

2K21  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
493042 confirmatory 2 / 0 / 3 Mode of action assay-Dose response assay for the identification of selective activators of KCNQ2 potassium channels in the KCNQ1/KCNE1 expressing cells on automated patch clamp
493186 screening 13 / 14 / 509 Specificity screen assay against KCNQ1/E1 for identification of compounds that potentiate KCNQ1 potassium channels
504418 confirmatory 0 / 0 / 5 Mode of action assay-Specificity dose response assay for the KCNQ2 activators in the KCNQ1/E1 expressing cells by the Tl flux
652147 screening 1203 / 0 / 350 Specificity screen against KCNQ1/KCNE1 for identification of compounds that inhibit KCNQ1 potassium channels

Gene RIF (160)

PMID Text
26662381 The incidence of AF among the senior Uygur population in Xinjiang territory was correlated with the KCNE1 (G38S) polymorphism, which may be an independent risk factor for Uygur AF patients.
26520166 Analysis of QT-RR relationship could also evaluate the latent arrhythmogenicity of KCNE1(G38S).
26410412 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation
26168993 The KCNQ1 F279I mutation induces a gain of function of IKs due to an impaired gating modulation of Kv7.1 induced by KCNE1, leading to a shortening of the cardiac action potential
26066992 This study aimed to assess the associations between polymorphisms on KCNE1, KCNQ1, and KCNH2 with the risk of AF in a Chinese population.
25497550 acute application of PUFAs increases Kv7.1/KCNE1 through a probably direct effect, and shows antiarrhythmic efficacy under IKr block.
25479336 IKs phosphorylation and alpha1-AR regulation via activation of calcium-dependent PKC isoforms (cPKC) may be a key mechanism to control channel voltage-dependent activation and consequently action potential duration (APD) in response to adrenergic-stimulus.
25366730 the KCNE1 112G polymorphism may be a risk factor for AF. KCNE1 112G>A may be useful as a biomarker for predicting the development of AF.
25234231 The resilience of the curvature in the KCNE1 transmembrane domain is likely to be maintained upon binding of protein to the KCNQ1 channel.
25037568 KCNE1 distal C-terminus appears essential for the regulation of yotiao-mediated PKA phosphorylation.
More...

AA Sequence

MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKK      1 - 70
LEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP                71 - 129
//

Publication (188)

PMID Year Title
26662381 2015 Correlation analysis between the delayed rectifier potassium channel KCNE1 (G38S) polymorphism and atrial fibrillation among the senior Uygur population in Xinjiang.
26520166 Abnormal repolarization dynamics in a patient with KCNE1(G38S) who presented with torsades de pointes.
26410412 2016 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation.
26168993 2015 A new KCNQ1 mutation at the S5 segment that impairs its association with KCNE1 is responsible for short QT syndrome.
26066992 2015 Genetic variants of potassium voltage-gated channel genes (KCNQ1, KCNH2, and KCNE1) affected the risk of atrial fibrillation in elderly patients.
25497550 2015 Marine n-3 PUFAs modulate IKs gating, channel expression, and location in membrane microdomains.
25479336 2015 Impaired IKs channel activation by Ca(2+)-dependent PKC shows correlation with emotion/arousal-triggered events in LQT1.
25366730 2014 KCNE1 112G>a polymorphism and atrial fibrillation risk: a meta-analysis.
25234231 2014 Structural investigation of the transmembrane domain of KCNE1 in proteoliposomes.
25037568 2014 Long QT mutations at the interface between KCNQ1 helix C and KCNE1 disrupt I(KS) regulation by PKA and PIP?.
More...