Property Summary

NCBI Gene PubMed Count 13
PubMed Score 36.23
PubTator Score 33.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15259
Symbols GSD10
PGAMM
PGAM-M

Gene

Gene RIF (1)

PMID Text
24786789 These results reveal a mechanism of PGAM2 regulation and NADPH homeostasis in response to oxidative stress that impacts cell proliferation and tumor growth.

AA Sequence

MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAI      1 - 70
LDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKER     71 - 140
RYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNL    141 - 210
PTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK                               211 - 253
//

Text Mined References (13)

PMID Year Title
24786789 2014 Oxidative stress activates SIRT2 to deacetylate and stimulate phosphoglycerate mutase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10545043 1999 Manifesting heterozygotes in a Japanese family with a novel mutation in the muscle-specific phosphoglycerate mutase (PGAM-M) gene.
8447317 1993 The molecular genetic basis of muscle phosphoglycerate mutase (PGAM) deficiency.
6262916 1981 Human muscle phosphoglycerate mutase deficiency: newly discovered metabolic myopathy.
4827367 1974 Phosphoglycerate mutase isozyme marker for tissue differentiation in man.
2822696 1987 Isolation of a cDNA encoding the muscle-specific subunit of human phosphoglycerate mutase.
More...