Property Summary

NCBI Gene PubMed Count 13
PubMed Score 37.08
PubTator Score 33.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy -2.365 1.4e-06
atypical teratoid / rhabdoid tumor -1.200 1.4e-03
autosomal dominant Emery-Dreifuss muscul... -1.176 7.6e-03
Duchenne muscular dystrophy -1.203 2.5e-05
ependymoma 1.500 1.1e-02
group 4 medulloblastoma -1.100 4.9e-02
juvenile dermatomyositis -1.416 1.0e-09

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAI      1 - 70
LDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKER     71 - 140
RYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNL    141 - 210
PTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK                               211 - 253
//

Text Mined References (13)

PMID Year Title