Property Summary

NCBI Gene PubMed Count 109
Grant Count 174
R01 Count 91
Funding $16,008,690.19
PubMed Score 301.62
PubTator Score 870.99

Knowledge Summary

Patent

No data available

Synonym

Accession P15248 IL-9
Symbols P40
HP40
IL-9

Gene

IL9

Gene RIF (93)

PMID Text
26751012 IL-9 is functionally active, and is a pro-growth/survival factor for the localized pathologic T cells in the synovium of inflammatory arthritis.
26191227 Asthmatic children showed an increase in plasma Il9 levels post Mycoplasma pneumoniae infection.
26131817 secretion increased in respiratory epithelial adenomatoid hamartoma tissue
26078482 Data demonstrated increased serum levels of IL-9 in systemic lupus erythematosus and rheumatoid arthritis patients but no association with clinical and laboratory parameters was found.
25913104 identified as a gene target that might interact with environmental exposure to dust mite allergen to increase asthma severity in children
25902303 Interleukin-9 Is Associated with Elevated Anti-Double-Stranded DNA Antibodies in Lupus-Prone Mice
25840641 show the regulation of the IL-9-STIM1-ERK-IL-8 axis in keratinocyte, and how the axis might play an important role in the pathophysiology of atopic dermatitis
25542095 association between IL-9 and diabetic kidney disease was complex as it was reduced in diabetes mellitus, but it was of normal levels in those with diabetic kidney disease
25393692 SF of BC OA displayed significantly higher concentrations for a number of proinflammatory cytokines [CXCL1, eotaxin, interferon (IFN)-gamma, interleukin (IL)-7, IL-8, IL-9, IL-12].
25112699 IL-9 is a key component of memory TH cell peanut-specific responses from children with peanut allergy (PA) and may be a useful biomarker to distinguish between children with PA and those with peanut sensitization.
More...

AA Sequence

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFS      1 - 70
ERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGM     71 - 140
RGKI                                                                      141 - 144
//

Publication (109)

PMID Year Title
26751012 2016 IL-9, a local growth factor for synovial T cells in inflammatory arthritis.
26191227 2015 Changes in levels of IL-9, IL-17, IFN-?, dendritic cell numbers and TLR expression in peripheral blood in asthmatic children with Mycoplasma pneumoniae infection.
26131817 2015 T-Helper Type 9 Cells Play a Central Role in the Pathogenesis of Respiratory Epithelial Adenomatoid Hamartoma.
26078482 2015 Increased Serum Interleukin-9 Levels in Rheumatoid Arthritis and Systemic Lupus Erythematosus: Pathogenic Role or Just an Epiphenomenon?
25913104 2015 Genome-wide expression profiles identify potential targets for gene-environment interactions in asthma severity.
25902303 2015 Interleukin-9 Is Associated with Elevated Anti-Double-Stranded DNA Antibodies in Lupus-Prone Mice.
25840641 2015 IL-9 induces IL-8 production via STIM1 activation and ERK phosphorylation in epidermal keratinocytes: A plausible mechanism of IL-9R in atopic dermatitis.
25542095 2015 Serum IL-9, IL-17, and TGF-? levels in subjects with diabetic kidney disease (CURES-134).
25393692 2015 Unicompartmental and bicompartmental knee osteoarthritis show different patterns of mononuclear cell infiltration and cytokine release in the affected joints.
25112699 2014 IL-9 is a key component of memory TH cell peanut-specific responses from children with peanut allergy.
More...