Property Summary

NCBI Gene PubMed Count 134
PubMed Score 1355.70
PubTator Score 664.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.6e-02

Protein-protein Interaction (1)

Gene RIF (61)

AA Sequence

MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVH      1 - 70
PAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNP     71 - 140
NQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGM    141 - 210
MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPP    211 - 280
RRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL                                  281 - 320
//

Text Mined References (139)

PMID Year Title