Property Summary

NCBI Gene PubMed Count 124
Grant Count 481
R01 Count 311
Funding $53,096,661.7
PubMed Score 1281.50
PubTator Score 664.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.016

Synonym

Accession P15172 O75321
Symbols PUM
MYF3
MYOD
bHLHc1

Gene

Gene RIF (51)

PMID Text
26902638 The mechanism of bakuchiol-induced myogenesis is described.
26234681 these results suggest that sarcoma metastasis can be partially controlled through Pax7/MyoD-dependent activation of miR-182 and provide insight into the role that myogenic transcription factors have in sarcoma progression
25651906 These observations demonstrated the first time that Wnt3a can directly activate MyoD expression through targeting cis-elements in the DE and the L fragment.
25403490 MUNC is not a classic cis-acting enhancer RNA (e-RNA) acting exclusively by stimulating the neighboring MyoD gene
25108351 MyoD acts to promote SC proliferation and transition of cells into differentiation, while myogenin is known to drive terminal differentiation
25055037 MyoD was required for the induction of FGF21 gene transcription by mitochondrial dysfunction.
25002625 A recurring point mutation in MYOD1 is found in 10% of embryonal rhabdomyosarcomas with distinct clinical features and poor prognosis.
24905980 Studies indicate that MyoD occupies multiple promoters that induce the transcription of genes vital for establishing the myogenic fate and is also implicated as a mediator of many chromatin modifying enzymes for their recruitment to myogenic enhancers.
24824843 Spindle cell and sclerosing rhabdomyosarcoma show recurrent MYOD1 mutations, in keeping with a single pathologic entity, regardless of age at presentation.
24793135 analysis of a mutation in MYOD1 that may have a role in progression of embryonal rhabdomyosarcoma and may be associated with mutations altering PI3K-AKT pathway components
More...

AA Sequence

MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVH      1 - 70
PAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNP     71 - 140
NQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGM    141 - 210
MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPP    211 - 280
RRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL                                  281 - 320
//

Text Mined References (129)

PMID Year Title
26902638 2016 Bakuchiol augments MyoD activation leading to enhanced myoblast differentiation.
26234681 2016 Myogenic transcription factors regulate pro-metastatic miR-182.
25651906 2015 Wnt3a signal pathways activate MyoD expression by targeting cis-elements inside and outside its distal enhancer.
25403490 2015 MUNC, a long noncoding RNA that facilitates the function of MyoD in skeletal myogenesis.
25108351 2014 The skeletal muscle satellite cell response to a single bout of resistance-type exercise is delayed with aging in men.
25055037 2014 FGF21 expression and release in muscle cells: involvement of MyoD and regulation by mitochondria-driven signalling.
25002625 2014 A MYOD1 mutation cooperates with PI3K pathway activation in ERMS.
24905980 2014 Activation of muscle enhancers by MyoD and epigenetic modifiers.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24824843 2014 Recurrent MYOD1 mutations in pediatric and adult sclerosing and spindle cell rhabdomyosarcomas: evidence for a common pathogenesis.
More...