Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $105,434.5
PubMed Score 49.00
PubTator Score 22.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15088 Q96E94 MC-CPA
Symbols MC-CPA

Gene

PANTHER Protein Class (3)

 Grant Application (2)

Gene RIF (4)

PMID Text
27157394 Carboxypeptidase A3 was differentially expressed between Fibromyalgia patients and healthy controls.
24726923 Urine CPA3 was increased in patients with chronic prostatitis/chronic pelvic pain syndrome compared to controls.
19643669 Role in regulating innate immunity responses and regulating secretory granule homeostasis
14760754 The cDNA encoding human colon mast cell carboxypeptidase can be successfully cloned and expressed in E. coli and P. pastoris.

AA Sequence

MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRV      1 - 70
SEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMV     71 - 140
SRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRM    141 - 210
NFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESE    211 - 280
KETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGP    281 - 350
IESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS       351 - 417
//

Text Mined References (24)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26385002 2016 Comparative proteome analysis of saccular intracranial aneurysms with iTRAQ quantitative proteomics.
26312864 2015 Multidimensional endotypes of asthma: topological data analysis of cross-sectional clinical, pathological, and immunological data.
25958181 2016 Mast cell proteases as pharmacological targets.
25640519 2016 Dietary treatment modulates mast cell phenotype, density, and activity in adult eosinophilic oesophagitis.
24726923 2014 Tryptase-PAR2 axis in experimental autoimmune prostatitis, a model for chronic pelvic pain syndrome.
24582314 2014 Sputum gene expression signature of 6 biomarkers discriminates asthma inflammatory phenotypes.
24220317 2014 Increased density of intraepithelial mast cells in patients with exercise-induced bronchoconstriction regulated through epithelially derived thymic stromal lymphopoietin and IL-33.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21713659 2011 Mast cell proteases as protective and inflammatory mediators.
More...