Property Summary

NCBI Gene PubMed Count 288
Grant Count 286
R01 Count 161
Funding $22,538,667.6
PubMed Score 732.46
PubTator Score 575.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession P14921 A9UL17 F5GYX9 Q14278 Q16080 Q6N087 Q96AC5
Symbols p54
ETS-1
EWSR2
c-ets-1

Gene

PANTHER Protein Class (1)

PDB

4LG0   1GVJ   2NNY   2STT   2STW   3MFK   3RI4   3WTS   3WTT   3WTU   3WTV   3WTW   3WTX   3WTY   3WTZ   3WU0   3WU1   4L0Y   4L0Z   4L18  

Gene RIF (234)

PMID Text
26938745 NR4As regulate gene transcription primarily through interaction with distal enhancers that are co-enriched for NR4A1 and ETS transcription factor motifs
26743285 the markers Ets-1 and APAF-1 relative to p53, Ki-67 and PTEN expression in colon adenomas/polyps, were investigated.
26389665 Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation.
26365772 c-ETS transcription factors appear to be key regulators of MCM4 origin where c-ETS2 seems to promote DNA replication whereas c-ETS1 functions as a negative regulator.
26296467 Fentanyl showed anti-tumor like effects on CRC cells, including less cell clone formation and inhibited cell migration and invasion.
26241881 A significant positive correlation was seen between ETS-1 rs73013527 and RA susceptibility. Carriers of the haplotype CCT or TCT for rs4937333, rs11221332 and rs73013527 had decreased risk. No effect was seen for rs10893872, rs4937333 and rs11221332.
26195629 Data show that proto-oncogene protein ETS1 transiently forms dimers as a consequence of interacting with any DNA sequence.
26177288 MiR-324-5p suppresses hepatocellular carcinoma cell invasion by counteracting extracellular matrix degradation through post-transcriptionally downregulating ETS1 and SP1.
26150526 These observations suggest that not only ERK1/2 but also Akt activity is essential to maintain Ets-1 in an active state.
26122040 By investigating the role of ERa in the ETS-1 activity regulation, we demonstrated that ERalpha may be a novel ETS-1 co-activator and thus a potential therapeutic target in human neuroblastoma treatment
More...

AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR      1 - 70
QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY     71 - 140
QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL    141 - 210
RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV    211 - 280
PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC    281 - 350
QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS    351 - 420
LLGYTPEELHAMLDVKPDADE                                                     421 - 441
//

Text Mined References (295)

PMID Year Title
26938745 2016 Genome Wide Mapping of NR4A Binding Reveals Cooperativity with ETS Factors to Promote Epigenetic Activation of Distal Enhancers in Acute Myeloid Leukemia Cells.
26743285 2015 Changes in immunoexpression of p53, Ki-67, Ets-1, APAF-1 and PTEN in serrated and conventional colon adenomas.
26389665 2015 Non-canonical NF-?B signalling and ETS1/2 cooperatively drive C250T mutant TERT promoter activation.
26365772 2015 c-ETS transcription factors play an essential role in the licensing of human MCM4 origin of replication.
26296467 2015 Fentanyl inhibits the invasion and migration of colorectal cancer cells via inhibiting the negative regulation of Ets-1 on BANCR.
26241881 2015 Association of E26 Transformation Specific Sequence 1 Variants with Rheumatoid Arthritis in Chinese Han Population.
26195629 2015 A Role for Autoinhibition in Preventing Dimerization of the Transcription Factor ETS1.
26177288 2015 MiR-324-5p Suppresses Hepatocellular Carcinoma Cell Invasion by Counteracting ECM Degradation through Post-Transcriptionally Downregulating ETS1 and SP1.
26150526 2015 EGFR inhibition evokes innate drug resistance in lung cancer cells by preventing Akt activity and thus inactivating Ets-1 function.
26122040 2015 Estrogen receptor ? enhances the transcriptional activity of ETS-1 and promotes the proliferation, migration and invasion of neuroblastoma cell in a ligand dependent manner.
More...