Property Summary

NCBI Gene PubMed Count 72
PubMed Score 793.96
PubTator Score 276.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.5
Disease Target Count Z-score Confidence
Waardenburg's syndrome 17 5.926 3.0

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.300 1.6e-06
Breast cancer -2.900 9.7e-32
breast carcinoma -1.200 5.5e-13
colon cancer -3.500 9.2e-06
cutaneous lupus erythematosus -1.100 3.9e-02
fibroadenoma 1.300 5.6e-03
group 3 medulloblastoma -1.100 1.7e-02
lung cancer 1.700 2.0e-04
psoriasis -1.400 1.4e-21
ulcerative colitis -1.127 2.3e-02

Gene RIF (29)

AA Sequence

MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTA      1 - 70
LQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKR     71 - 140
SAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDL    141 - 210
HHPKLMPGSGLALAPSTCPRCLFQEGAP                                              211 - 238
//

Text Mined References (72)

PMID Year Title