Property Summary

NCBI Gene PubMed Count 70
Grant Count 135
R01 Count 64
Funding $20,300,350.79
PubMed Score 766.24
PubTator Score 276.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.039
ulcerative colitis -1.600 0.000
colon cancer -3.500 0.000
lung cancer 1.700 0.000
fibroadenoma 1.300 0.006
atypical teratoid/rhabdoid tumor -1.300 0.000
group 4 medulloblastoma -1.200 0.001
Breast cancer -2.900 0.000
breast carcinoma -1.200 0.000
psoriasis -1.400 0.000

Synonym

Accession P14138 E1P5I5 Q03229 Q7Z6D2 Q9UGT7 ET-3
Symbols ET3
ET-3
WS4B
HSCR4
PPET3

Gene

PANTHER Protein Class (2)

Gene RIF (27)

PMID Text
24647318 EDN3 expression in left internal mammary arteries depends on tissue harvesting technique.
24379252 Waardenburg syndrome type II and mutations of EDNRB, EDN3 and SOX10 genes are responsible for Waardenburg syndrome type IV. (review)
23904381 Down-regulated expression of ET3 attenuates the malignant behaviors of human melanoma cells partially by decreasing the expression of SPARC.
23515723 Our data showed that almost all patients, regardless of individual characteristics such as gender or age, expressed the endothelin receptor genes, but did not express the genes for ET-3.
22921304 plasma levels of big ET-2, and big ET-3 are markedly increased in patients with end stage renal disease on hemodialysis
22876130 A novel missense mutation in EDN3 and a deletion mutation in DMD has been found in the same Indian family members affected with Waardenburg syndrome and Duchenne muscular dystrophy.
22865632 Studies revealed hypermethylation of EDN2 and EDN3 genes in human primary colon cancers and in a panel of human colon cancer cell lines. Epigenetic inactivation of ET-2 and ET-3 occurs frequently in both rat and human colon cancers.
22013079 These data suggest that autocrine EDN3/EDNRB signaling is essential for maintaining GSCs. Incorporating END3/EDNRB-targeted therapies into conventional cancer treatments may have clinical implication for the prevention of tumor recurrence.
21813388 ET-1 and the ET-1/ET-3 ratio are elevated in cirrhotic patients with portopulmonary hypertension (PPHT) and that ET-1 is associated with a poor outcome irrespective of PPHT.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTA      1 - 70
LQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKR     71 - 140
SAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDL    141 - 210
HHPKLMPGSGLALAPSTCPRCLFQEGAP                                              211 - 238
//

Text Mined References (69)

PMID Year Title
24647318 2015 The comparison of traditional and modified harvesting techniques of left ?nternal mammary artery regarding endothelin-1/2/3 expression and free flow capacity.
24379252 2013 [Hereditary hypomelanocytoses: the role of PAX3, SOX10, MITF, SNAI2, KIT, EDN3 and EDNRB genes].
23904381 2013 Silencing endothelin-3 expression attenuates the malignant behaviors of human melanoma cells by regulating SPARC levels.
23753411 2013 Genomic association analysis of common variants influencing antihypertensive response to hydrochlorothiazide.
23515723 2012 Gene expression of endothelin receptors in replaced rheumatic mitral stenotic valves.
22921304 2012 Increased plasma levels of big-endothelin-2 and big-endothelin-3 in patients with end-stage renal disease.
22897442 2012 Apolipoprotein B is a new target of the GDNF/RET and ET-3/EDNRB signalling pathways.
22876130 2012 Genetic analysis of an Indian family with members affected with Waardenburg syndrome and Duchenne muscular dystrophy.
22865632 2013 Epigenetic inactivation of endothelin-2 and endothelin-3 in colon cancer.
22013079 2011 Autocrine endothelin-3/endothelin receptor B signaling maintains cellular and molecular properties of glioblastoma stem cells.
More...