Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.98
PubTator Score 11.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession P13928 A6NDE6 A6NLM1 B4DKI1 B4DTC9 Q5T2P8 Q5VTM4 Q6GMY3 Q9BT34
Symbols ANXA8
ANXA8L2
VAC-beta
bA145E20.2

Gene

PDB

1W3W   1W45  

Gene RIF (1)

PMID Text
18223320 Claudin 18 and annexin A8 are frequently highly overexpressed in infiltrating ductal adenocarcinomas.

AA Sequence

MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKD      1 - 70
LTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYG     71 - 140
SSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILCTRSA    141 - 210
THLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI    211 - 280
VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP                           281 - 327
//

Text Mined References (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
18223320 2008 New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15928709 2005 Annexins: linking Ca2+ signalling to membrane dynamics.
15644210 2005 The crystal structure of annexin A8 is similar to that of annexin A3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...