Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.63
PubTator Score 11.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.5e-09

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.5e-09

Gene RIF (1)

AA Sequence

MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKD      1 - 70
LTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYG     71 - 140
SSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILCTRSA    141 - 210
THLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI    211 - 280
VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP                           281 - 327
//

Text Mined References (17)

PMID Year Title