Property Summary

NCBI Gene PubMed Count 33
PubMed Score 315.32
PubTator Score 144.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.9
Disease Target Count Z-score Confidence
Amino acid metabolic disorder 5 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 6.0e-03
Multiple myeloma 1.560 1.1e-03
ovarian cancer -1.200 6.0e-03
pancreatic ductal adenocarcinoma liver m... -2.744 4.7e-03

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKV      1 - 70
AGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKS     71 - 140
PDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLTKSDRP    141 - 210
ELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGI    211 - 280
SGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK                     281 - 333
//

Text Mined References (42)

PMID Year Title