Property Summary

NCBI Gene PubMed Count 40
Grant Count 15
R01 Count 15
Funding $2,495,437.5
PubMed Score 68.19
PubTator Score 51.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.786 0.000
group 4 medulloblastoma -2.800 0.000
Duchenne muscular dystrophy 1.398 0.000
autosomal dominant Emery-Dreifuss muscul... 1.411 0.024
juvenile dermatomyositis 1.275 0.000
primary pancreatic ductal adenocarcinoma 1.685 0.003
active Crohn's disease 1.433 0.018
ulcerative colitis 1.600 0.000
spina bifida -2.236 0.044
Breast cancer -1.700 0.000
invasive ductal carcinoma -1.300 0.008
acute myeloid leukemia -2.500 0.030
ovarian cancer -3.400 0.000
pancreatic cancer 1.600 0.000
dermatomyositis 1.200 0.046

Gene RIF (32)

PMID Text
26573968 PLS3 is a genuine spinal muscular atrophy protective modifier in SMN1-deleted individuals
26134627 High levels of recombinant hPLS3 mRNA were expressed in motor neurons of SMA mice and an increased level of PLS3 protein in total spinal cord, yet neither survival nor the fundamental electrophysiological aspects of the neuromuscular junction improved.
26114395 Measurements of SMN and PLS3 transcript and protein levels in induced pluripotent stem cell-derived motor neurons show limited value as Spinal muscular atrophy biomarkers.
26048141 plastin 3 is a regulator of actin microfilament bundles at the ES in which it dictates the configuration of the filamentous actin network
25880010 PLS3 was expressed in circulating tumor cells undergoing the epithelial-mesenchymal transition in patients with breast cancer; an excellent biomarker for identifying groups at risk of recurrence or with a poor prognosis
25226517 T-plastin expression downstream to the calcineurin/NFAT pathway is involved in keratinocyte migration.
25209159 results confirm the role of PLS3 mutations in early onset osteoporosis. The mechanism whereby PLS3 affects bone health is unclear, but it may be linked to osteocyte dendrite function and skeletal mechanosensing
24284364 PLS3 expression and SMA phenotype: a commentary on correlation of PLS3 expression with disease severity in children with spinal muscular atrophy.
24271012 Loss of PLS3 is associated with spinal muscular atrophy.
24217791 PLS3 overexpression is associated with colorectal cancer.
More...

AA Sequence

MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDG      1 - 70
KISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALEND     71 - 140
PDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCH    141 - 210
VVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFH    211 - 280
LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCR    281 - 350
QFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY    351 - 420
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGN    421 - 490
QTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLID    491 - 560
AIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV    561 - 630
//

Text Mined References (48)

PMID Year Title
26573968 2016 Plastin 3 is upregulated in iPSC-derived motoneurons from asymptomatic SMN1-deleted individuals.
26134627 2015 Plastin 3 Expression Does Not Modify Spinal Muscular Atrophy Severity in the ?7 SMA Mouse.
26114395 2015 Decay in survival motor neuron and plastin 3 levels during differentiation of iPSC-derived human motor neurons.
26048141 2015 Actin-bundling protein plastin 3 is a regulator of ectoplasmic specialization dynamics during spermatogenesis in the rat testis.
25880010 2015 Circulating tumour cell-derived plastin3 is a novel marker for predicting long-term prognosis in patients with breast cancer.
25226517 2014 T-plastin expression downstream to the calcineurin/NFAT pathway is involved in keratinocyte migration.
25209159 2015 A novel splice mutation in PLS3 causes X-linked early onset low-turnover osteoporosis.
24284364 2014 PLS3 expression and SMA phenotype: a commentary on correlation of PLS3 expression with disease severity in children with spinal muscular atrophy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24271012 2014 Calcium binding is essential for plastin 3 function in Smn-deficient motoneurons.
More...