Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.16
PubTator Score 36.12

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MTAELREAMALAPWGPVKVKKEEEEEENFPGQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISW      1 - 70
DMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGAETKNLQLLVPKTEICEEAEKPLIISE     71 - 140
RIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSGGKYSLNSGAV    141 - 210
KNPKTQLGQKPFTCSVCGKGFSQSANLVVHQRIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVC    211 - 280
SKCGKAFTQSSNLTVHQKIHSLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLI    281 - 350
VHQRIHTGEKPFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDC    351 - 420
SECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECGKAFRQRSSLT    421 - 490
VHQRTHTGEKPYECEKCGAAFISNSHLMRHHRTHLVE                                     491 - 527
//

Text Mined References (11)

PMID Year Title
20186958 2010 Expression of zinc finger protein 105 in the testis and its role in male fertility.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8477855 1993 The ZNF35 human zinc finger gene encodes a sequence-specific DNA-binding protein.
7814019 1995 Positional cloning of cDNAs from the human chromosome 3p21-22 region identifies a clustered organization of zinc-finger genes.
3380682 1988 Isolation of cDNAs encoding finger proteins and measurement of the corresponding mRNA levels during myeloid terminal differentiation.
2108922 1990 Localization of the human HF.10 finger gene on a chromosome region (3p21-22) frequently deleted in human cancers.
More...