Property Summary

NCBI Gene PubMed Count 155
Grant Count 140
R01 Count 96
Funding $11,833,180.96
PubMed Score 645.83
PubTator Score 579.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.023
osteosarcoma 1.040 0.002
non-small cell lung cancer 4.731 0.000
lung cancer 1.900 0.005
breast carcinoma -2.900 0.000
interstitial cystitis -1.400 0.042
group 3 medulloblastoma -1.100 0.008
posterior fossa group B ependymoma 1.100 0.017
Breast cancer -4.600 0.000

Synonym

Accession P13647 Q6PI71 Q6UBJ0 Q8TA91
Symbols K5
CK5
DDD
DDD1
EBS2
KRT5A

Gene

PDB

3TNU  

Gene RIF (89)

PMID Text
26743602 KRT5 protein mutation may predispose to a severe lethal variant of epidermolysis bullosa simplex.
26708602 Authors herein defined two distinct HNSCCs groups (EGFR(+) and K5(+)) with several sub-classes, identifiable by the additional assessment of p53, Bcl2 and CD117.
26432462 identification of 29 different mutations in KRT5 and KRT14, 11 of which were novel, in a Polish cohort of epidermolysis bullosa simplex patients
25961909 Keratinocytes adhesion and stiffness depends on KRT5 protein missense mutation.
25944390 Different staining patterns can be seen with CK5/6 and p63; however, if they are used together with TTF-1 they can be used in subtyping lung neoplasms.
25742793 CK5/6 have roles in biologically aggressive tumors likely to display resistance to trastuzumab ab initio in women diagnosed with HER2+ cancer
25337222 CK5/6, IMP3 and TTF1 immunostaining appears to be useful to improve the accuracy of cytological diagnoses between reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25143125 immunoreactivity cytokeratin 5 and CD44 commonly immunostained Nested/microcystic urothelial carcinoma (US) and some invasive high grade UC
25063315 There were differences between CK5/6, p63,CK34betaE12 and TTF-1 expression with tumor differentiation in squamous cell carcinoma or adenocarcinomas
25017986 in silico analysis of all epidermolysis bullosa simplex causing point mutations on the 2B domain of K5 and K14; result showed all pathogenic point mutations exert their dominant negative effect on the K5/K14 coiled-coil heterodimer complex by altering interchain interaction,leading to changes in stability and assembly competence of the heterodimer complex
More...

AA Sequence

MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGG      1 - 70
SKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGGAGFGGGFGGPGFPVCPPGGI     71 - 140
QEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKT    141 - 210
VRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVD    211 - 280
AAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIA    281 - 350
NRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR    351 - 420
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVN    421 - 490
ISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGVGLGGGLSVGGSGFSASSGRG    491 - 560
LGVGFGSGGGSSSSVKFVSTTSSSRKSFKS                                            561 - 590
//

Text Mined References (161)

PMID Year Title
26743602 2016 The p.Glu477Lys Mutation in Keratin 5 Is Strongly Associated with Mortality in Generalized Severe Epidermolysis Bullosa Simplex.
26708602 Epidermal Growth Factor Receptor (EGFR) and Keratin 5 (K5): Versatile Keyplayers Defining Prognostic and Therapeutic Sub-classes of Head and Neck Squamous Cell Carcinomas.
26432462 2016 Novel sporadic and recurrent mutations in KRT5 and KRT14 genes in Polish epidermolysis bullosa simplex patients: further insights into epidemiology and genotype-phenotype correlation.
25961909 2015 Distinct Impact of Two Keratin Mutations Causing Epidermolysis Bullosa Simplex on Keratinocyte Adhesion and Stiffness.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944390 2015 The Value of Cytokeratin 5/6, p63 and Thyroid Transcription Factor-1 in Adenocarcinoma, Squamous Cell Carcinoma and Non-Small-Cell Lung Cancer of the Lung.
25742793 2015 Cytokeratin 5/6 fingerprinting in HER2-positive tumors identifies a poor prognosis and trastuzumab-resistant basal-HER2 subtype of breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25337222 2014 A fine decision tree consisted of CK5/6, IMP3 and TTF1 for cytological diagnosis among reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25143125 2014 Nested and microcystic variants of urothelial carcinoma displaying immunohistochemical features of basal-like urothelial cells: an immunohistochemical and histopathogenetic study.
More...