Property Summary

NCBI Gene PubMed Count 62
PubMed Score 141.99
PubTator Score 117.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
periodontitis 269 5.19736513789167E-30
non-small cell lung cancer 2798 5.44837447281329E-26
lung carcinoma 2844 5.93961938986397E-22
juvenile dermatomyositis 1189 7.77220913062515E-13
lung adenocarcinoma 2714 1.56223861992389E-8
ependymoma 2514 8.14026507051715E-8
medulloblastoma, large-cell 6234 3.43051486763301E-7
group 4 medulloblastoma 1875 5.3915504519761E-7
atypical teratoid / rhabdoid tumor 4369 8.11965239102028E-7
interstitial cystitis 2299 1.79712606829411E-5
ulcerative colitis 2087 2.346785419569E-5
nephrosclerosis 329 2.42275559001794E-5
osteosarcoma 7933 1.75948206580078E-4
psoriasis 6685 3.37520094427159E-4
lung cancer 4473 4.60628046771858E-4
ductal carcinoma in situ 1745 5.21771186286023E-4
breast carcinoma 1614 6.38745884067135E-4
adult high grade glioma 2148 6.75120833932246E-4
invasive ductal carcinoma 2950 0.00145451330959739
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00228698763889146
primitive neuroectodermal tumor 3031 0.0036433618039759
tuberculosis and treatment for 6 months 686 0.00397019913403807
glioblastoma 5572 0.0055260743967515
ovarian cancer 8492 0.00825559049431731
dermatomyositis 967 0.00996797851278877
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0177589619368959
esophageal adenocarcinoma 737 0.0236505183310326
Disease Target Count Z-score Confidence
Colon carcinoma in situ 8 3.456 1.7
Cancer 2346 3.017 1.5

Expression

  Differential Expression (27)

Synonym

Accession P13598 Q14600 ICAM-2
Symbols CD102

Gene

PDB

1ZXQ  

  Ortholog (8)

 GO Function (1)

Gene RIF (28)

PMID Text
26377944 Soluble ICAM2 was higher in ADHD patients than in controls.
25427141 ICAM-1 and ICAM-2 are involved in each step of neutrophil extravasation, and have redundant but also distinct functions. Analysis of the role of endothelial ICAM-1 requires simultaneous consideration of ICAM-2.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of intercellular adhesion molecule 2 (ICAM2, CD102)
24704826 Results indicate that the interaction of ICAM-2 with alpha-actinin is critical to conferring an ICAM-2-mediated non-metastatic phenotype in neuroblastoma cells.
24474251 with larger patient groups and preferably detailed histopathological and clinical evaluations, are needed to explain the severity of ICAM-1, ICAM-2, and ICAM-3 molecules in Barrett's esophagus
24457076 ICAM-2 was significantly more pronounced in plasma cell mastitis than in nonpathologic breast tissue. However, no significant differences in ICAM-2 immunoreactivity were detected between ductal epithelium of PCM and non-PCM.
23714211 Reduced glycosylation of ICAM-2 significantly attenuated, but did not abolish, its ability to suppress metastatic properties of neuroblastoma cells.
23591197 These findings suggested that the downregulated miR-125b expression was associated with proliferation and radioresistance mechanisms, probably through ICAM2 signalling.
22190034 Both HIV-1 Nef and Vpu downregulate the cell surface expression of intercellular adhesion molecule 2 (ICAM2, CD102)
20955708 Immune surveillance occurs during the early intraepithelial stages of human pancreatic carcinogenesis and is mediated by expression of CXCL17 and ICAM2.
More...

AA Sequence

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD      1 - 70
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE     71 - 140
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP    141 - 210
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP         211 - 275
//

Text Mined References (65)

PMID Year Title
26377944 2015 Relationship between soluble intercellular adhesion molecules and attention-deficit/hyperactivity disorder.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25427141 2015 The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues.
24704826 2015 ICAM-2 confers a non-metastatic phenotype in neuroblastoma cells by interaction with ?-actinin.
24474251 2014 Investigation of intercellular adhesion molecules (ICAMs) gene expressions in patients with Barrett's esophagus.
24457076 2014 Intercellular adhesion molecule 1/2 and E-selectin in plasma cell mastitis: immunohistochemical study of 35 cases.
23714211 2013 N-glycosylation of ICAM-2 is required for ICAM-2-mediated complete suppression of metastatic potential of SK-N-AS neuroblastoma cells.
23591197 2013 MicroRNA-125b regulates proliferation and radioresistance of oral squamous cell carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20955708 2011 CXCL17 and ICAM2 are associated with a potential anti-tumor immune response in early intraepithelial stages of human pancreatic carcinogenesis.
More...