Property Summary

NCBI Gene PubMed Count 278
Grant Count 154
R01 Count 98
Funding $10,926,933.09
PubMed Score 358.80
PubTator Score 315.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.203 0.041
Barrett's esophagus 1.200 0.038
esophageal adenocarcinoma 1.600 0.018
cutaneous lupus erythematosus 1.700 0.003
psoriasis 2.300 0.000
glioblastoma 2.100 0.001
osteosarcoma 1.023 0.015
posterior fossa group A ependymoma 1.700 0.000
periodontitis 1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.551 0.021
interstitial cystitis 1.400 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.757 0.022
invasive ductal carcinoma 1.154 0.004
lung carcinoma -1.200 0.000
ovarian cancer 1.600 0.000
pancreatic cancer 1.100 0.004

Synonym

Accession P13498 Q14090 Q9BR72
Symbols p22-PHOX

Gene

PDB

1WLP  

Gene RIF (299)

PMID Text
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26415877 Downregulating p22phox ameliorates inflammatory response in Angiotensin II-induced oxidative stress by regulating MAPK and NF-kappaB pathways in retinal pigment cells.
26317224 increased levels of gp91phox, p47phox and p22phox likely account for the interferon-gamma mediated enhancement of dimethyl sulfoxide-induced Nox2 activity.
26244812 Data show that p22phox expression correlated with Epstein-Barr virus (EBV) and its encoded oncoprotein, latent membrane protein 1 (LMP1) expression.
26130419 C936T polymorphism of the VEGF gene and the C242T polymorphism of the p22phox gene are not correlated with diabetes mellitus type 2 and distal diabetic polyneuropathy.
26117319 TRX-1/PRX-1 levels are associated with NADPH oxidase-activity in vivo and in vitro in atherosclerosis.
25990054 the C242T polymorphism might be a protective factor against developing acute coronary syndrome in the Asian population [meta-analysis]
25888935 results suggest the evaluated NOX4 and CYBA SNPs are not direct genetic determinants of fibrosis in patients with chronic hepatitis C
25862415 A functional variant in the promoter of the CYBA gene is associated with reduced renal function and with prevalence and incidence of diabetic nephropathy and end-stage renal disease in type 1 diabetic patients.
25823784 our present analysis reinforces the involvement in ACT of the regulatory NADPH oxidase subunit RAC2 gene variant rs13058338 and, to a lesser extent of the CYBA gene variant rs4673.
More...

AA Sequence

MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQ      1 - 70
KYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRE     71 - 140
RPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV                   141 - 195
//

Text Mined References (285)

PMID Year Title
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26415877 2015 Downregulating p22phox ameliorates inflammatory response in Angiotensin II-induced oxidative stress by regulating MAPK and NF-?B pathways in ARPE-19 cells.
26317224 2015 INF-? Enhances Nox2 Activity by Upregulating phox Proteins When Applied to Differentiating PLB-985 Cells but Does Not Induce Nox2 Activity by Itself.
26244812 2015 LMP1 Increases Expression of NADPH Oxidase (NOX) and Its Regulatory Subunit p22 in NP69 Nasopharyngeal Cells and Makes Them Sensitive to a Treatment by a NOX Inhibitor.
26130419 2015 Association study of C936T polymorphism of the VEGF gene and the C242T polymorphism of the p22phox gene with diabetes mellitus type 2 and distal diabetic polyneuropathy.
26117319 2015 Thioredoxin-1/peroxiredoxin-1 as sensors of oxidative stress mediated by NADPH oxidase activity in atherosclerosis.
25990054 2015 Meta-analysis of C242T polymorphism in CYBA genes: risk of acute coronary syndrome is lower in Asians but not in Caucasians.
25888935 2015 Association of a variant in the regulatory region of NADPH oxidase 4 gene and metabolic syndrome in patients with chronic hepatitis C.
25862415 2015 Allelic variations in the CYBA gene of NADPH oxidase and risk of kidney complications in patients with type 1 diabetes.
25823784 2015 Association of NADPH oxidase polymorphisms with anthracycline-induced cardiotoxicity in the RICOVER-60 trial of patients with aggressive CD20(+) B-cell lymphoma.
More...