Property Summary

NCBI Gene PubMed Count 291
PubMed Score 376.05
PubTator Score 315.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Chronic granulomatous disease 13

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.6e-06
Barrett's esophagus 1.200 3.8e-02
cutaneous lupus erythematosus 1.700 3.2e-03
ependymoma 1.300 6.3e-06
esophageal adenocarcinoma 1.600 1.8e-02
glioblastoma 2.100 9.8e-04
interstitial cystitis 1.200 5.7e-03
invasive ductal carcinoma 1.154 4.3e-03
lung carcinoma -1.200 2.3e-15
Multiple myeloma 1.203 4.1e-02
osteosarcoma 1.023 1.5e-02
ovarian cancer 1.600 1.4e-05
pancreatic cancer 1.100 4.0e-03
pancreatic ductal adenocarcinoma liver m... 1.551 2.1e-02
periodontitis 1.500 5.0e-24
psoriasis 2.300 5.2e-05
subependymal giant cell astrocytoma 1.757 2.2e-02

Protein-protein Interaction (1)

Gene RIF (312)

AA Sequence

MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQ      1 - 70
KYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRE     71 - 140
RPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV                   141 - 195
//

Text Mined References (298)

PMID Year Title