Property Summary

Ligand Count 299
NCBI Gene PubMed Count 75
PubMed Score 232.68
PubTator Score 1790.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.032 7.0e-03
atypical teratoid / rhabdoid tumor 1.200 3.5e-05
ependymoma 1.100 5.7e-05
glioblastoma 2.000 5.6e-07
interstitial cystitis 1.400 4.5e-05
lung cancer -1.800 9.1e-04
lung carcinoma -1.300 3.3e-10
malignant mesothelioma -1.300 1.7e-06
medulloblastoma, large-cell 1.400 7.1e-05
non-small cell lung cancer 1.378 5.4e-15
osteosarcoma 1.885 5.7e-06
ovarian cancer -1.300 1.3e-06
pediatric high grade glioma 1.300 1.4e-04

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (51)

AA Sequence

MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQ      1 - 70
AVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG     71 - 140
GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGI    141 - 210
VVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG    211 - 280
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW    281 - 350
RISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS    351 - 420
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAY    421 - 490
DYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCE    491 - 560
QRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRIS    561 - 630
LQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHF    631 - 700
FSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSK    701 - 770
KECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR    771 - 840
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFE    841 - 910
VEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQD    911 - 980
TLHSRK                                                                    981 - 986
//

Text Mined References (77)

PMID Year Title