Property Summary

NCBI Gene PubMed Count 66
Grant Count 96
R01 Count 42
Funding $10,435,648.68
PubMed Score 220.09
PubTator Score 1790.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma 1.885 0.000
posterior fossa group A ependymoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 2.000 0.000
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer 1.378 0.000
lung cancer -1.800 0.001
active Crohn's disease -1.032 0.007
interstitial cystitis 1.400 0.000
pediatric high grade glioma 1.300 0.000
lung carcinoma -1.300 0.000
ovarian cancer -1.300 0.000

Synonym

Accession P13497 A8K6F5 B2RN46 D3DSR0 Q13292 Q13872 Q14874 Q99421 Q99422 Q99423 Q9UL38 BMP-1
Symbols PCP
TLD
OI13
PCP2
PCOLC

Gene

PANTHER Protein Class (2)

PDB

3EDG   3EDH  

Gene RIF (45)

PMID Text
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
25701650 Data indicate that BMP-1 can simultaneously trigger matrix assembly and boost the synthesis of matrix proteins via a direct effect on growth factors in the contexts of development, growth and tissue repair. [review]
25656619 study thus highlights the severe and progressive nature of BMP1-associated OI in adults and broadens insights into the functional consequences of BMP1/mTLD-deficiency on ECM organization.
25402547 Two novel variants in the BMP1 gene: c.808A>G and c.1297G>T care associated with osteogenesis imperfecta.
25214535 Frequent bone fracture in children is cause by BMP1-1 deficiency.
25158199 mutations of the DSP-PP P4 to P4' cleavage site can block, impair or accelerate dentin sialoprotein phosphophoryn cleavage, and suggest that its Bone morphogenic protein 1 cleavage site is conserved in order to regulate its cleavage efficiency
24984282 High BMP1 expression is associated with type-1 diabetes.
24042462 Loss of bone morphogenetic protein is associated with prostate cancer.
23640157 Sequence analysis of BMP1 genes did not reveal any putative mutations for hyperostosis cranialis interna to chromosome 8p21
23584484 miR-194 suppresses metastasis of non-small cell lung cancer through regulating expression of BMP1 and p27kip1
More...

AA Sequence

MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQ      1 - 70
AVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG     71 - 140
GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGI    141 - 210
VVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG    211 - 280
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW    281 - 350
RISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS    351 - 420
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAY    421 - 490
DYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCE    491 - 560
QRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRIS    561 - 630
LQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHF    631 - 700
FSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSK    701 - 770
KECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR    771 - 840
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFE    841 - 910
VEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQD    911 - 980
TLHSRK                                                                    981 - 986
//

Text Mined References (68)

PMID Year Title
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
25701650 BMP-1/tolloid-like proteinases synchronize matrix assembly with growth factor activation to promote morphogenesis and tissue remodeling.
25656619 2015 Defective Proteolytic Processing of Fibrillar Procollagens and Prodecorin Due to Biallelic BMP1 Mutations Results in a Severe, Progressive Form of Osteogenesis Imperfecta.
25543063 2015 K153R polymorphism in myostatin gene increases the rate of promyostatin activation by furin.
25402547 2015 Identification and in vivo functional characterization of novel compound heterozygous BMP1 variants in osteogenesis imperfecta.
25214535 2015 A polyadenylation site variant causes transcript-specific BMP1 deficiency and frequent fractures in children.
25158199 2014 Site specificity of DSP-PP cleavage by BMP1.
24984282 2014 Placental antiangiogenic prolactin fragments are increased in human and rat maternal diabetes.
24042462 2013 Contextual effect of repression of bone morphogenetic protein activity in prostate cancer.
23829672 2013 Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2.
More...