Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.95
PubTator Score 14.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19825936 Prox1 and HoxD8 play important roles in the maturation and maintenance of lymphatic vessels.
19453261 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHA      1 - 70
HPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYD     71 - 140
NLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTL    141 - 210
ELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQEL    211 - 280
EEDRAEGLTN                                                                281 - 290
//

Text Mined References (18)

PMID Year Title
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19825936 2009 Identification of targets of Prox1 during in vitro vascular differentiation from embryonic stem cells: functional roles of HoxD8 in lymphangiogenesis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12357469 2002 Limb malformations and the human HOX genes.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11060466 2000 Clustering of two fragile sites and seven homeobox genes in human chromosome region 2q31-->q32.1.
10364522 1999 Monodactylous limbs and abnormal genitalia are associated with hemizygosity for the human 2q31 region that includes the HOXD cluster.
More...