Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.34
PubTator Score 14.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHA      1 - 70
HPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYD     71 - 140
NLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTL    141 - 210
ELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQEL    211 - 280
EEDRAEGLTN                                                                281 - 290
//

Text Mined References (20)

PMID Year Title