Property Summary

NCBI Gene PubMed Count 111
Grant Count 124
R01 Count 74
Funding $19,977,648.69
PubMed Score 556.59
PubTator Score 465.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.839 0.000
group 3 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.230 0.000
lung cancer 2.400 0.000
nasopharyngeal carcinoma 1.100 0.000
acute myeloid leukemia -1.800 0.038
ovarian cancer 1.900 0.000

Synonym

Accession P13051 A8K5M6 B2R8Y1 O00637 O00719 Q93028 UDG
Symbols DGU
UDG
UNG1
UNG2
HIGM4
HIGM5
UNG15

Gene

UNG

PDB

1AKZ   1DPU   1EMH   1EMJ   1Q3F   1SSP   1UGH   1YUO   2HXM   2OXM   2OYT   2SSP   3FCF   3FCI   3FCK   3FCL   3TKB   4SKN   5AYR  

 GO Component (2)

Gene RIF (158)

PMID Text
27068393 The authors show that Vpr can form a trimolecular complex with UNG2 and RPA32 and the positive effect of UNG2 and RPA32 on the reverse transcription process leading to optimal virus replication and dissemination between the primary target cells of HIV-1.
26867650 Data suggest novel mechanism in innate immunity allows cytokine TGF-beta to restrict viral circular DNA in hepatocyte nuclei via innate immunity; AID deaminates circular DNA of hepatitis B virus leading to DNA degradation; mechanism depends on UNG.
25807049 HIV-1 Vpr downregulates the gene expression of UNG2 and amino-acid residues A30/V31 are critical for the Vpr-mediated downregulation of UNG2
25704090 HIV-1 Vpr downregulates the gene expression of UNG2 and amino-acid residues A30/V31 are critical for the Vpr-mediated downregulation of UNG2
25704090 HIV-1 Vpr downregulates the gene expression of UNG2 and amino-acid residues A30/V31 are critical for the Vpr-mediated downregulation of UNG2
25408964 UNG interaction with damaged DNA is dominated by the nonelectrostatic free energy term (DeltaGnon = -7.2 +/- 0.1 kcal mol(-1)), yet retains the nonspecific electrostatic contribution (DeltaGelect = -2.3 +/- 0.2 kcal mol(-1)).
25301111 UNG rs246079 G/A contributes to decreased risk of esophageal cancer in a Chinese population.
25154417 Data shows that cancer cells express UNG2 gene at levels similar to or higher than those seen with peripheral B cells.
24951587 base excision by UNG1/2 perturbs transcription of the affected gene
24899191 HIV-1 Vpr downregulates the gene expression of UNG2 and amino-acid residues A30/V31 are critical for the Vpr-mediated downregulation of UNG2
More...

AA Sequence

MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ      1 - 70
LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM     71 - 140
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL    141 - 210
LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP    211 - 280
LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL                                         281 - 313
//

Text Mined References (121)

PMID Year Title
27068393 2016 Uracil DNA glycosylase interacts with the p32 subunit of the replication protein A complex to modulate HIV-1 reverse transcription for optimal virus dissemination.
26867650 2016 TGF-? triggers HBV cccDNA degradation through AID-dependent deamination.
25408964 2014 Electrostatic properties of complexes along a DNA glycosylase damage search pathway.
25301111 2014 Uracil-DNA glycosylase (UNG) rs246079 G/A polymorphism is associated with decreased risk of esophageal cancer in a Chinese population.
25154417 2014 Genomic uracil homeostasis during normal B cell maturation and loss of this balance during B cell cancer development.
24951587 2014 Excision of uracil from transcribed DNA negatively affects gene expression.
24910198 2014 Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins.
23873851 2013 Uracil-DNA glycosylase expression determines human lung cancer cell sensitivity to pemetrexed.
23714858 2014 Association between polymorphism of the DNA repair SMUG1 and UNG genes and age-related macular degeneration.
23705837 2013 Structural role of uracil DNA glycosylase for the recognition of uracil in DNA duplexes. Clues from atomistic simulations.
More...