Property Summary

NCBI Gene PubMed Count 50
Grant Count 18
R01 Count 8
Funding $1,710,188.11
PubMed Score 98.55
PubTator Score 97.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26475168 These results suggest that the iEA index or a combination of polymorphisms in EGFR and ANXA3 may serve as predictive factors of drug response, and therefore could be useful for optimal selection of chemotherapy regimens.
26116899 HIV-1 Vpr downregulates the expression of ANXA3 in human monocyte-derived dendritic cells
26095609 Our results suggest that ANXA3 can serve as a novel diagnostic biomarker and that the inhibition of ANXA3 may be a viable therapeutic option for the treatment of CD133+ liver-CSC-driven HCC.
26093083 ANX A3 has roles as a mammary biomarker, regulator and therapeutic target in breast cancer
25267273 findings suggest that ANXA3 plays a role in HCC CSC/CIC maintenance, and that ANXA3 may represent a potential CSC/CIC-specific therapeutic target for improving the treatment of HCC.
24954692 Two different antigenic variants of ANXA3 are present in post-DRE urines and their clinical significance for diagnosis of prostate cancer should be further investigated.
24884814 Urinary calreticulin, annexin A2, and annexin A3 are very likely a panel of biomarkers with potential value for upper tract urothelial carcinoma diagnosis.
24824926 Annexin A3 was upregulated in gastric cancer cells. Deletion of endogenous Annexin A3 significantly inhibited gastric cancer cell proliferation, migration, and invasion.
24815437 Expression of annexin A3 was increased in gastric cancer compared with that in normal gastric tissues. Annexin A3 expression was significantly associated with tumor volume and TNM stage.
24375474 Findings reveal that ANXA3 might play an important role in hepatocellular carcinoma progression and chemoresistance.
More...

AA Sequence

MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD      1 - 70
DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL     71 - 140
GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK    141 - 210
LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS    211 - 280
EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD                               281 - 323
//

Text Mined References (52)

PMID Year Title
26475168 2015 Construction of possible integrated predictive index based on EGFR and ANXA3 polymorphisms for chemotherapy response in fluoropyrimidine-treated Japanese gastric cancer patients using a bioinformatic method.
26095609 2015 ANXA3/JNK Signaling Promotes Self-Renewal and Tumor Growth, and Its Blockade Provides a Therapeutic Target for Hepatocellular Carcinoma.
26093083 2015 Annexin A3 is a mammary marker and a potential neoplastic breast cell therapeutic target.
25267273 2015 Annexin A3 as a potential target for immunotherapy of liver cancer stem-like cells.
24954692 2014 Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
24884814 2014 A panel of tumor markers, calreticulin, annexin A2, and annexin A3 in upper tract urothelial carcinoma identified by proteomic and immunological analysis.
24824926 2014 Impact of Annexin A3 expression in gastric cancer cells.
24815437 2014 Expression of annexin A3 in gastric cancer and its correlation with proliferation and apoptosis.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24375474 2015 Annexin A3 promotes tumorigenesis and resistance to chemotherapy in hepatocellular carcinoma.
More...