Property Summary

Ligand Count 602
NCBI Gene PubMed Count 607
PubMed Score 1755.91
PubTator Score 1517.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ -1.800 2.5e-02
interstitial cystitis 1.400 9.2e-04
medulloblastoma, large-cell 1.100 1.2e-03
nephrosclerosis 1.257 5.8e-04
osteosarcoma -3.326 5.0e-09
ovarian cancer 1.200 9.3e-08
pancreatic ductal adenocarcinoma liver m... -1.442 6.3e-03

Gene RIF (661)

AA Sequence

MLAATVLTLALLGNAHACSKGTSHEAGIVCRITKPALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLG      1 - 70
QVKYGLHNIQISHLSIASSQVELVEAKSIDVSIQNVSVVFKGTLKYGYTTAWWLGIDQSIDFEIDSAIDL     71 - 140
QINTQLTCDSGRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQICKEINVISNI    141 - 210
MADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHKGHFIYKNVSEDLPLPTFSPTLLGDSRMLYF    211 - 280
WFSERVFHSLAKVAFQDGRLMLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISC    281 - 350
QNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVTTVQASYSKKKLFLSLLDFQITPKTVSNLTESSSE    351 - 420
SVQSFLQSMITAVGIPEVMSRLEVVFTALMNSKGVSLFDIINPEIITRDGFLLLQMDFGFPEHLLVDFLQ    421 - 490
SLS                                                                       491 - 493
//

Text Mined References (609)

PMID Year Title