Property Summary

NCBI Gene PubMed Count 571
Grant Count 96
R01 Count 55
Funding $15,131,899.8
PubMed Score 317.51
PubTator Score 1517.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis 1.257 0.001
osteosarcoma -3.326 0.000
medulloblastoma, large-cell 1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.442 0.006
interstitial cystitis 1.400 0.001
ductal carcinoma in situ -1.800 0.025
ovarian cancer 1.200 0.000

Synonym

Accession P11597 Q13987 Q13988 Q53YZ1
Symbols BPIFF
HDLCQ10

Gene

PDB

2OBD   4EWS   4F2A  

Gene RIF (625)

PMID Text
26829743 No significant difference was found in the CETP gene I405V and D442G genotypes between the cerebral hemorrhage patients and controls.
26758205 CETP per se has no impact on the glucose tolerance and tissue uptake, global insulin sensitivity and beta cell insulin secretion rates.
26694435 The polymorphism of CETP genes rs708272, rs3764261, rs1800775, rs711752, rs12149545 was closely related to the dyslipidemia in the Xinjiang Uyghur and Kazakh ethnic groups; and the rs708272 T, rs3764261 T, rs711752 A, and rs12149545 A alleles could reduce risk of dyslipidemia in the Uyghur and Kazakh populations, however, the rs1800775 C allele showed risk factors
26683795 results point out that in addition to the common CETP variants, rare genetic variants in the CETP gene also contribute to the phenotypic variation of HDL-C in the general population
26642708 circulating CETP and Lp-PLA2 might partly play a role in the atherogenic disturbances in patients with iron deficiency anemia through increased susceptibility to lipid peroxidation
26503844 The cholesteryl ester transfer protein (CETP) rs3764261 variant was significantly associated with an increased risk of AMD
26370976 our results show the involvement of the variants of ESR1, LPL and CETP genes in metabolic events related to MetS or some of its features.
26318399 Presence of CETP SNP rs3764261 is not associated with insulin resistance and incident T2DM in patients with clinically manifest vascular disease
26313355 CETP can protect against the obesity-induced impairment in exercise capacity and may be a target to improve exercise capacity in the context of obesity
26261636 SNPs in SORT1, CETP and GCKR were individually associated with lipid level variations in Algerian population.
More...

AA Sequence

MLAATVLTLALLGNAHACSKGTSHEAGIVCRITKPALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLG      1 - 70
QVKYGLHNIQISHLSIASSQVELVEAKSIDVSIQNVSVVFKGTLKYGYTTAWWLGIDQSIDFEIDSAIDL     71 - 140
QINTQLTCDSGRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQICKEINVISNI    141 - 210
MADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHKGHFIYKNVSEDLPLPTFSPTLLGDSRMLYF    211 - 280
WFSERVFHSLAKVAFQDGRLMLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISC    281 - 350
QNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVTTVQASYSKKKLFLSLLDFQITPKTVSNLTESSSE    351 - 420
SVQSFLQSMITAVGIPEVMSRLEVVFTALMNSKGVSLFDIINPEIITRDGFLLLQMDFGFPEHLLVDFLQ    421 - 490
SLS                                                                       491 - 493
//

Text Mined References (573)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26829743 2016 [Association of CETP gene I405V/D442G polymorphisms with cerebral hemorrhage and serum lipid profile in ethnic Han population from Changsha].
26758205 2016 Cholesteryl Ester Transfer Protein (CETP) expression does not affect glucose homeostasis and insulin secretion: studies in human CETP transgenic mice.
26694435 2015 Association between Eight Functional Polymorphisms and Haplotypes in the Cholesterol Ester Transfer Protein (CETP) Gene and Dyslipidemia in National Minority Adults in the Far West Region of China.
26683795 2016 Resequencing of the CETP gene in American whites and African blacks: Association of rare and common variants with HDL-cholesterol levels.
26642708 2015 The Relationship Between Lipoprotein-Associated Phospholipase A(2), Cholesteryl Ester Transfer Protein and Lipid Profile and Risk of Atherosclerosis in Women with Iron Deficiency Anaemia.
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26370976 2015 Polymorphisms in the LPL and CETP Genes and Haplotype in the ESR1 Gene Are Associated with Metabolic Syndrome in Women from Southwestern Mexico.
26318399 2015 Association between CETP gene polymorphism, insulin resistance and risk of diabetes mellitus in patients with vascular disease.
26313355 2015 CETP Expression Protects Female Mice from Obesity-Induced Decline in Exercise Capacity.
More...