Property Summary

NCBI Gene PubMed Count 25
PubMed Score 645.13
PubTator Score 385.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.500 0.000

Synonym

Accession P11441 Q5HY80
Symbols GDX
G6PD
GET5
MDY2
UBL4
TMA24
DX254E
DXS254E

Gene

PDB

4WWR   4X86   2DZI  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (8)

PMID Text
25535373 Both TRC35 and Ubl4A have distinct C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
25415308 Data show that molecular chaperone BAG6_ubiquitin-like domain (UBL) and ubiquitin-like 4A UBL4A_UBL compete for the same binding site on N-terminal dimerisation domain of SGTA protein (SGTA_NT).
24424410 The authors identify USP13 as a gp78-associated deubiquitinase that eliminates ubiquitin conjugates from Ubl4A to maintain the functionality of Bag6.
23723067 Data indicate that BCL2-associated athanogene 6 (BAG6) appears to be the central component for the process, as depletion of BAG6 leads to the loss of both UBL4A and GET4 proteins and resistance to cell killing by DNA-damaging agents.
23665563 Data indicate that the Bag6-Ubl4A-Trc35 complex is localized to the endoplasmic reticulum (ER) membrane to regulate ER-associated degradation (ERAD).
23246001 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23142665 Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.
22190034 HIV-1 Vif is identified to have a physical interaction with ubiquitin-like 4A (UBL4A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV      1 - 70
VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS     71 - 140
RFLHPEVTETMEKGFSK                                                         141 - 157
//

Text Mined References (32)

PMID Year Title
25535373 2015 Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.
25416956 2014 A proteome-scale map of the human interactome network.
25415308 2014 Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
23723067 2013 Nuclear BAG6-UBL4A-GET4 complex mediates DNA damage signaling and cell death.
23665563 2013 A ubiquitin-like domain recruits an oligomeric chaperone to a retrotranslocation complex in endoplasmic reticulum-associated degradation.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142665 2012 Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.
More...