Property Summary

Ligand Count 79
NCBI Gene PubMed Count 67
PubMed Score 158.21
PubTator Score 299.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 7.9e-03
Astrocytoma, Pilocytic -2.100 9.1e-09
atypical teratoid / rhabdoid tumor -1.600 7.5e-03
colon cancer -1.700 2.3e-03
ductal carcinoma in situ -1.300 1.9e-03
glioblastoma -1.800 9.5e-05
group 3 medulloblastoma -1.900 1.3e-03
invasive ductal carcinoma -1.400 1.1e-02
malignant mesothelioma 1.400 7.4e-05
medulloblastoma, large-cell -2.000 1.3e-05
posterior fossa group B ependymoma 1.500 1.1e-04
primitive neuroectodermal tumor -2.400 2.4e-06
psoriasis -1.500 3.8e-60
subependymal giant cell astrocytoma -1.925 8.6e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (34)

AA Sequence

MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIR      1 - 70
TQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRL     71 - 140
AACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHT    141 - 210
SQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVL    211 - 280
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPEL    281 - 350
MRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP    351 - 420
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPR    421 - 490
RWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINP    491 - 560
NSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDV    561 - 630
VNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM    631 - 700
AEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHD    701 - 770
RFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE    771 - 840
AI                                                                        841 - 842
//

Text Mined References (67)

PMID Year Title