Property Summary

NCBI Gene PubMed Count 36
PubMed Score 48.38
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.500 3.1e-03
lung carcinoma 1.100 2.6e-19
Multiple myeloma 1.015 2.6e-02
ovarian cancer -1.300 2.0e-04
pancreatic ductal adenocarcinoma liver m... -1.186 2.7e-03

Protein-protein Interaction (13)

Gene RIF (9)

AA Sequence

MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVS      1 - 70
RGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPV     71 - 140
PIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPF    141 - 210
EFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIE    211 - 280
ASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDII    281 - 350
FAIKKTLNI                                                                 351 - 359
//

Text Mined References (44)

PMID Year Title