Property Summary

NCBI Gene PubMed Count 35
PubMed Score 44.58
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.015 0.026
pancreatic ductal adenocarcinoma liver m... -1.186 0.003
lung cancer 1.500 0.003
lung carcinoma 1.100 0.000
ovarian cancer 2.100 0.000

Synonym

Accession P11177 B2R7L0 B4DDD7 Q6FH45 Q9BQ27 Q9UFK3 PDHE1-B
Symbols PDHBD
PHE1B
PDHE1-B

Gene

PANTHER Protein Class (2)

PDB

1NI4   2OZL   3EXE   3EXF   3EXG   3EXH   3EXI  

Gene RIF (11)

PMID Text
25720494 Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability
25088999 PHD3 depletion did not affect the expression of the PDH-E1alpha, E1beta, and E2 subunits, or the phosphorylation status of E1alpha, but destabilized the PDH complex (PDC), resulting in less functional PDC.
23125841 Tandem affinity purification and mass spectrometry analysis identify pyruvate dehydrogenase subunit beta (PDHB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify pyruvate dehydrogenase subunit beta (PDHB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify pyruvate dehydrogenase subunit beta (PDHB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify pyruvate dehydrogenase subunit beta (PDHB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
19924563 Sequencing of PDHB reveals a homozygous point mutation (c.302T>C), causing a predicted amino acid change in patient 1. Patient 2 is compound heterozygote for mutations c.301A>G (p.M101V) and c.313G>A (p.R105Q).
18206651 Species specificity in the interaction between hE1beta and hE2 in pyruvate dehydrogenase complex.
18164639 clinical findings are similar to those of PDHA1 deficiency, except that ataxia was more frequent in PDHA1 cases and consanguinity was found only in PDHB families.
More...

AA Sequence

MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVS      1 - 70
RGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPV     71 - 140
PIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPF    141 - 210
EFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIE    211 - 280
ASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDII    281 - 350
FAIKKTLNI                                                                 351 - 359
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25720494 2015 ATP6AP2/(pro)renin receptor contributes to glucose metabolism via stabilizing the pyruvate dehydrogenase E1 ? subunit.
25088999 2014 Prolyl-hydroxylase PHD3 interacts with pyruvate dehydrogenase (PDH)-E1? and regulates the cellular PDH activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19924563 2009 PDH E1? deficiency with novel mutations in two patients with Leigh syndrome.
19081061 2008 Structural basis for inactivation of the human pyruvate dehydrogenase complex by phosphorylation: role of disordered phosphorylation loops.
More...