Property Summary

NCBI Gene PubMed Count 35
Grant Count 10
R01 Count 4
Funding $1,706,075.67
PubMed Score 203.94
PubTator Score 286.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.514 0.001
Multiple myeloma 1.983 0.000
astrocytic glioma -1.200 0.008
ependymoma -1.100 0.024
osteosarcoma -1.751 0.000
medulloblastoma -1.200 0.000
Breast cancer 2.600 0.027
cystic fibrosis -1.500 0.000
invasive ductal carcinoma -1.300 0.000
ovarian cancer -2.100 0.000

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (10)

PMID Text
26337638 rs7996797 located on chr13q14.1-q14.2 near the ESD gene was the most significantly associated with hallux valgus in females in genome-wide association meta-analyses.
22944692 Positional proteomics analysis identifies the cleavage of human esterase D (ESD; S-formylglutathione hydrolase) at amino acid residues 76-77 by the HIV-1 protease
21596165 Abhydrolase domain-containing protein 11 and Esterase D predict the development of distant metastases and the presence of aggressive lung adenocarcinomas.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19126594 catalytic triad residues--Ser-153, His264, and Asp230--involved in catalysis. Mutagenesis of any of the catalytic triad residues to alanine abolished the enzyme activity. Backbone amides of Leu54 & Met150 are involved in the formation of the oxyanion hole
18552983 Autoantibodies to EsteD and BB-CK produced in experimental autoimmune uveoretinitis -induced mice were also detected in some endogenous uveitis patients, suggesting that these proteins might be autoantigens.
12942785 The analysis involved the data on nine polymorphic codominant loci: HP, GC, TF, PI, PGM1, GLO1, C3, ACP1, and ESD. The loci were selected by significance of differences in genotype frequencies between tuberculosis patients and healthy controls
11963573 Observational study of genotype prevalence. (HuGE Navigator)
11785295 Observational study of gene-disease association. (HuGE Navigator)
11436564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS      1 - 70
ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP     71 - 140
QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS    141 - 210
YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYL    211 - 280
NA                                                                        281 - 282
//

Text Mined References (40)

PMID Year Title
26337638 2015 Genome-wide association meta-analyses to identify common genetic variants associated with hallux valgus in Caucasian and African Americans.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21596165 2011 Activity-based proteomics: identification of ABHD11 and ESD activities as potential biomarkers for human lung adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...