Property Summary

NCBI Gene PubMed Count 35
PubMed Score 210.30
PubTator Score 286.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 7.8e-03
Breast cancer 2.600 2.7e-02
cystic fibrosis -1.300 1.5e-04
ependymoma -1.100 2.4e-02
invasive ductal carcinoma -1.100 3.5e-04
medulloblastoma -1.200 1.2e-04
Multiple myeloma 1.144 3.6e-03
osteosarcoma -1.751 3.9e-06
ovarian cancer -2.100 2.8e-11
Waldenstrons macroglobulinemia 1.423 1.0e-02

Gene RIF (10)

AA Sequence

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS      1 - 70
ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP     71 - 140
QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS    141 - 210
YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYL    211 - 280
NA                                                                        281 - 282
//

Text Mined References (40)

PMID Year Title