Property Summary

NCBI Gene PubMed Count 37
PubMed Score 310.92
PubTator Score 128.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Porphyria, Erythropoietic 2 0.0 0.0
Disease Target Count Z-score Confidence
Porphyria 10 0.0 5.0
Disease Target Count
Congenital erythropoietic porphyria 2

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.500 2.6e-05
astrocytic glioma -1.400 1.3e-02
ependymoma -1.600 2.1e-02
glioblastoma -1.100 4.0e-05
group 4 medulloblastoma -1.100 9.1e-04
medulloblastoma, large-cell -1.100 5.5e-03
osteosarcoma -2.939 4.0e-07
ovarian cancer 1.700 3.3e-05
subependymal giant cell astrocytoma 1.629 1.6e-02

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAA      1 - 70
ELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLL     71 - 140
FPCGNLKREILPKALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQE    141 - 210
LSGDNIDQIKFAAIGPTTARALAAQGLPVSCTAESPTPQALATGIRKALQPHGCC                   211 - 265
//

Text Mined References (37)

PMID Year Title