Property Summary

NCBI Gene PubMed Count 170
Grant Count 148
R01 Count 61
Funding $26,483,271.36
PubMed Score 244.97
PubTator Score 263.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10644 K7ER48 Q567S7
Symbols CAR
CNC
CNC1
PKR1
TSE1
ADOHR
PPNAD1
PRKAR1
ACRDYS1

Gene

Gene RIF (121)

PMID Text
26797121 P-Rex1 contributes to the spatiotemporal localization of type I PKA, which tightly regulates this guanine exchange factor by a multistep mechanism.
26619967 In the absence of a PRKAR1A gene mutation, our Cushing's syndrome patients do not fit the criteria for Carney's complex
26416542 The truncated enzyme lacks the functional cyclic adenosine monophosphate (cAMP) binding domain at the C-terminus, causing PRKAR1A haploinsufficiency.
26405036 this study evaluated the functional characteristics of PRKAR1A regulatory subunits carrying eight different mutations identified in patients with acrodysostosis and compared the results with those obtained for the two alternative mutations involved in the Carney complex
26354069 Letter/Case Report: novel PRKAR1A mutation resulting in a splicing variant in a case of Carney complex.
26088133 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3beta to A-kinase Anchoring Protein 220.
25890363 PRKAR1A gene mutation of c.491_492delTG is associated with multiple and extensive cardiac myxomas and skin pigmentation.
25870248 PRKAR1A gene and its locus are altered in mixed odontogenic tumors. Expression is decreased in a subset of tumors, and Prkar1a(+) (/) (-) mice do not show abnormalities, which indicates that additional genes play a role in this tumor's pathogenesis.
25576349 Case Report: although there was no family history of any of the Carney complex features and no mutations in the PRKAR1A gene were found, findings lead to the diagnosis of sporadic Carney complex.
25477193 Leu206Arg and Leu199_Cys200insTrp mutations in PRKACA impair its association with PRKAR2B and PRKAR1A.
More...

AA Sequence

MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK      1 - 70
AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH     71 - 140
LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP    141 - 210
RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ    211 - 280
KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL    281 - 350
DRPRFERVLGPCSDILKRNIQQYNSFVSLSV                                           351 - 381
//

Text Mined References (193)

PMID Year Title
26797121 2016 Protein Kinase A (PKA) Type I Interacts with P-Rex1, a Rac Guanine Nucleotide Exchange Factor: EFFECT ON PKA LOCALIZATION AND P-Rex1 SIGNALING.
26619967 2015 PRKAR1A-negative familial Cushing's syndrome: two case reports.
26416542 2015 A Novel Inherited Mutation in PRKAR1A Abrogates PreRNA Splicing in a Carney Complex Family.
26405036 2015 Functional Characterization of PRKAR1A Mutations Reveals a Unique Molecular Mechanism Causing Acrodysostosis but Multiple Mechanisms Causing Carney Complex.
26354069 2015 A novel PRKAR1A mutation resulting in a splicing variant in a case of Carney complex.
26088133 2015 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3? to A-kinase Anchoring Protein 220.
25890363 2015 Case studies of two related Chinese patients with Carney complex presenting with extensive cardiac myxomas and PRKAR1A gene mutation of c.491_492delTG.
25870248 2015 Defects of the Carney complex gene (PRKAR1A) in odontogenic tumors.
25576349 2015 Sporadic Carney complex without PRKAR1A mutation in a young patient with ischemic stroke.
25477193 2014 PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit.
More...