Property Summary

NCBI Gene PubMed Count 33
Grant Count 65
R01 Count 46
Funding $8,013,729.95
PubMed Score 1025.27
PubTator Score 1106.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P10323 Q6ICK2
Symbols

Gene

ACR

PANTHER Protein Class (3)

Gene RIF (4)

PMID Text
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
23297503 Sperm DNA damage is closely related with sperm-nucleoprotein transition, acrosin activity and seminal parameters.
22452365 DNA immunization against proacrosin impairs fertility in male mice.
15950651 Binding sites for recombinant human zona pellucida (ZP) glycoproteins located at the N- and C-termini of proacrosin reveal a key role of the proenzyme in the interaction.

AA Sequence

MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQIFTYNSHRY      1 - 70
HTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVEKIIIHEKYNSATEG     71 - 140
NDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPRPSSILMEARVDLIDLDLCN    141 - 210
STQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP    211 - 280
YLNWIASKIGSNALRMIQSATPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSP    281 - 350
PPPPPPPASPLPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKNHYDMETTELPELTST    351 - 420
S//

Text Mined References (33)

PMID Year Title
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
23297503 2012 [Sperm DNA damage and sperm-nucleoprotein transition correlate to acrosin activity and seminal parameters].
22452365 2012 DNA immunization against proacrosin impairs fertility in male mice.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15955892 The proacrosin binding protein, sp32, is tyrosine phosphorylated during capacitation of pig sperm.
15950652 2005 Binding of recombinant human proacrosin/acrosin to zona pellucida glycoproteins. II. Participation of mannose residues in the interaction.
15950651 2005 Binding of recombinant human proacrosin/acrosin to zona pellucida (ZP) glycoproteins. I. Studies with recombinant human ZPA, ZPB, and ZPC.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12931362 2003 [The effect of semen antisperm antibody on human sperm acrosin activity].
More...