Property Summary

NCBI Gene PubMed Count 224
Grant Count 250
R01 Count 172
Funding $25,594,218.59
PubMed Score 925.47
PubTator Score 937.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

MYB

 GO Component (2)

Gene RIF (161)

PMID Text
27032383 PIAS1 enhances p300 recruitment to c-Myb-bound sites through interaction with both proteins. In addition, the E3 activity of PIAS1 enhances further its coactivation
26829751 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI
26829750 our study identifies super-enhancer translocations that drive MYB expression and provides insight into downstream MYB functions in alternate adenoid cystic carcinoma lineages.
26657649 MYB is aberrantly overexpressed in PC cells and acts as a key determinant of pancreatic tumour growth and metastasis
26462877 In summary, our results implicate that metastatic properties of some RMS subtypes might be linked to c-Myb function.
26208222 Our data suggest that c-Myb is a transcription factor with multifaceted target regulation depending on cell type.
26089205 Our results show that a subset of prostatic basal cell carcinoma s harbors rearrangement of MYB
26076064 Results indicate that cutaneous adenoid cystic carcinomas possess the same types of MYB alterations as ACCs of other anatomic sites.
25963073 Stage and margin status were important prognostic factors for ACC. Tumors with evidence of MYB-NFIB fusion were more likely to originate in minor salivary glands
25928412 conserved regulatory elements within the MYB core enhancer in individuals with sickle cell disease
More...

AA Sequence

MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYL      1 - 70
PNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNP     71 - 140
EVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAV    141 - 210
ATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAI    211 - 280
QRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE    281 - 350
HHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT    351 - 420
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQT    421 - 490
PSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTS    491 - 560
PVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYV    561 - 630
NAFSARTLVM                                                                631 - 640
//

Text Mined References (227)

PMID Year Title
27032383 2016 PIAS1 binds p300 and behaves as a coactivator or corepressor of the transcription factor c-Myb dependent on SUMO-status.
26829751 2016 MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism.
26829750 2016 An oncogenic MYB feedback loop drives alternate cell fates in adenoid cystic carcinoma.
26657649 2015 MYB is a novel regulator of pancreatic tumour growth and metastasis.
26462877 2015 The Expression of c-Myb Correlates with the Levels of Rhabdomyosarcoma-specific Marker Myogenin.
26208222 2015 c-Myb Binding Sites in Haematopoietic Chromatin Landscapes.
26089205 2015 A subset of prostatic basal cell carcinomas harbor the MYB rearrangement of adenoid cystic carcinoma.
26076064 2015 Detection of MYB Alterations and Other Immunohistochemical Markers in Primary Cutaneous Adenoid Cystic Carcinoma.
25963073 2015 MYB rearrangement and clinicopathologic characteristics in head and neck adenoid cystic carcinoma.
25928412 2015 Genetic association of fetal-hemoglobin levels in individuals with sickle cell disease in Tanzania maps to conserved regulatory elements within the MYB core enhancer.
More...