Property Summary

NCBI Gene PubMed Count 36
Grant Count 72
R01 Count 29
Funding $6,514,679.21
PubMed Score 164.84
PubTator Score 129.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.558 0.006
psoriasis -1.100 0.000
astrocytoma 1.200 0.000
glioblastoma 1.200 0.000
oligodendroglioma 1.200 0.000
osteosarcoma 2.482 0.000
primitive neuroectodermal tumor 1.200 0.000
acute quadriplegic myopathy 1.014 0.000
lung cancer 1.200 0.001
Breast cancer 2.500 0.028
posterior fossa group A ependymoma 1.100 0.000
Pick disease 1.100 0.000
progressive supranuclear palsy -1.100 0.045
ovarian cancer 2.300 0.000
dermatomyositis 1.800 0.000

Synonym

Gene

Gene RIF (14)

PMID Text
26382853 These findings establish a link among the lupus autoantigen Ro60, Alu retroelements, and type I interferon.
23698747 The Y3 RNA moiety of the Ro60 ribonucleoprotein plays a critical role in the pathogenesis of fetal cardiac injury by altering the subcellular location of Ro60 autoantibodies.
23644453 Findings indicate a relentless turnover of short-lived clonotypic variants, masquerading as long-lived Ro60 humoral autoimmunity.
22114317 these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei.
21060685 conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs
20237496 Observational study of gene-disease association. (HuGE Navigator)
20224770 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity
20131295 dichotomy of human autoantibody responses against mutually exclusive determinants linked to a single domain of a systemic autoantigen and supports a model in which tolerance is broken by different immunogenic forms of Ro 60
20089705 Activation of Toll-like receptors by fetal factor Ro60-associated single-stranded RNA particles is relevant in autoimmune-associated congenital heart block, where the obligate maternal factor is an anti-SSA/Ro autoantibody.
19248095 results demonstrate that Ro 60 functions as a novel receptor for beta(2)GPI on the surface of apoptotic cells. The formation of Ro 60-beta(2)GPI complexes may protect against anti-Ro 60 autoantibody-mediated tissue injury.
More...

AA Sequence

MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG      1 - 70
CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK     71 - 140
CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH    141 - 210
ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA    211 - 280
LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL    281 - 350
KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV    351 - 420
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM    421 - 490
DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI                          491 - 538
//

Text Mined References (47)

PMID Year Title
26382853 2015 The Ro60 autoantigen binds endogenous retroelements and regulates inflammatory gene expression.
23698747 2013 Ro60 requires Y3 RNA for cell surface exposure and inflammation associated with cardiac manifestations of neonatal lupus.
23644453 2013 Long-term Ro60 humoral autoimmunity in primary Sjögren's syndrome is maintained by rapid clonal turnover.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22114317 2012 The zipcode-binding protein ZBP1 influences the subcellular location of the Ro 60-kDa autoantigen and the noncoding Y3 RNA.
21269460 2011 Initial characterization of the human central proteome.
21060685 2010 Ribonucleoprotein particles containing non-coding Y RNAs, Ro60, La and nucleolin are not required for Y RNA function in DNA replication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20224770 2010 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity.
More...