Property Summary

NCBI Gene PubMed Count 38
PubMed Score 175.77
PubTator Score 129.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.014 2.1e-04
astrocytoma 1.200 1.4e-30
Breast cancer 2.500 2.8e-02
dermatomyositis 1.800 8.9e-05
glioblastoma 1.100 1.3e-05
lung cancer 1.200 1.1e-03
Multiple myeloma 1.558 6.3e-03
oligodendroglioma 1.200 6.1e-20
osteosarcoma 2.482 5.2e-08
ovarian cancer -1.600 3.7e-06
Pick disease 1.100 6.7e-06
posterior fossa group A ependymoma 1.100 3.4e-07
primitive neuroectodermal tumor 1.200 6.2e-06
progressive supranuclear palsy -1.100 4.5e-02
psoriasis -1.100 4.6e-04

Gene RIF (16)

AA Sequence

MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG      1 - 70
CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK     71 - 140
CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH    141 - 210
ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA    211 - 280
LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL    281 - 350
KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV    351 - 420
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM    421 - 490
DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI                          491 - 538
//

Text Mined References (49)

PMID Year Title