Property Summary

NCBI Gene PubMed Count 31
PubMed Score 49.19
PubTator Score 23.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
non-Hodgkin lymphoma 6 0.0 0.9
Disease Target Count Z-score Confidence
Perrault syndrome 19 3.398 1.7
Klippel-Feil syndrome 15 3.392 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 3.4e-02
ependymoma -1.300 4.7e-02
glioblastoma -1.300 9.3e-06
interstitial cystitis -1.200 1.7e-04
intraductal papillary-mucinous adenoma (... -1.300 3.4e-03
lung cancer 1.100 1.2e-03
Multiple myeloma 1.310 1.3e-02
non primary Sjogren syndrome sicca 1.200 2.4e-02
oligodendroglioma -1.700 1.1e-02
osteosarcoma -1.012 2.2e-02
ovarian cancer -1.700 1.7e-05
sonic hedgehog group medulloblastoma 1.600 1.5e-03
spina bifida -1.448 4.8e-02

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY      1 - 70
TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF            71 - 133
//

Text Mined References (34)

PMID Year Title