Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.7e-09

Expression

Synonym

Accession P0DO92
Symbols

 Compartment GO Term (0)

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQ      1 - 70
ATQISKRAFFTKT                                                              71 - 83
//

Text Mined References (3)

PMID Year Title