Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILMTVSNSHLHMPMYFFLGNLSFL      1 - 70
DICYTTSSVPLILDSFLTPRKTISFSACAVQMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMSKA     71 - 140
AYMPKAAGSWVAGSTASMVQTSLAMRLPFCGDNIINHFTCEILAVLKLACADISVNVISMGVTNVIFLGV    141 - 210
PVLFISFSYVFIIATILRIPSAEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDPLGADKQDLADKL    211 - 280
ISLFYGVVTPMLNPIIYSLRNKDVKAAVRDLIFQKCFA                                    281 - 318
//

Text Mined References (3)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.