Property Summary

NCBI Gene PubMed Count 29
PubMed Score 0.00
PubTator Score 12.41

Knowledge Summary

Patent

No data available

Gene RIF (26)

AA Sequence

MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPL      1 - 70
PSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIW     71 - 140
SKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC              141 - 200
//

Text Mined References (28)

PMID Year Title