Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DKL9
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MNEQSEKNNSIQERHTDHSFPEKNCQIGQKQLQQIERQLKCLAFRNPGPQVADFNPETRQQKKKARMSKM      1 - 70
NEYFSTKYKIMRKYDKSGRLICNDADLCDCLEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESG     71 - 140
EVISTLPFNVPD                                                              141 - 152
//

Text Mined References (2)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.