Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.9e-10

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.9e-10

AA Sequence

MENQEFLSSSAPSEVTDGQVSTEISTCSEVFQKPIVLRILDTHRELEESEDPEKHENPEEPEEVREQDQR      1 - 70
DESEECDEPHESYEPHAPYAPHKPRDSYAPYELHGPHAAPKLLKAREPRQLRHTREPRKSREAKETELLP     71 - 140
SAAVMISPSLITRAPPRPQLSFLGANPVSCDFVRKCFSSRKRTPNLSKPKKQWGTPDRKLFWGNQDPIRP    141 - 210
VSQGALKAQLTKRLENLAQPKEVSCHYVPNRAQYYHSCGRESVIWEITPPALFRQPSKRIQRLSQPNGFK    211 - 280
RQCLLNRPFSDNSARDSLRISDPSPRILQLSVAKGTDPNYHPSKKMQTKISLSTLSAIATPRIIELAHPR    281 - 350
IKLEGLCYERQRSELPIRPVPPAAMIAKPSPRTIALAKSKSVHQDYLPDRDAHWPVSYATTHSKASPRIQ    351 - 420
ELANPNKRAPVRIVYYDPDVFKTKPAALKAQCSQRIWELSQPLTR                             421 - 465
//

Text Mined References (2)

PMID Year Title