Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -2.000 2.4e-02
intraductal papillary-mucinous adenoma (... 1.200 1.5e-03
ulcerative colitis -1.100 6.1e-04

AA Sequence

MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGEEE              1 - 62
//

Text Mined References (5)

PMID Year Title