Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.92
PubTator Score 1.17

Knowledge Summary

Patent

No data available

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI      1 - 70
MAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQR     71 - 140
EKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLF    141 - 210
FRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAE    211 - 280
ILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS                                        281 - 314
//

Text Mined References (4)

PMID Year Title