Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.63
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
tuberculosis 1,557 3.457 1.7

Expression

Gene RIF (2)

PMID Text
19296525 Our data show that the TMSB15A and TMSB15B isoforms have distinct expression patterns in different tumor cell lines and tissues.
17567946 TMSL8 is well conserved in many mammalian species. Two isoforms, thymosin beta15a and b, exist at different locations, 1.4Mb apart, on human chromosome X, with 98% identity across the coding sequences.

AA Sequence

MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS                               1 - 45
//

Text Mined References (6)

PMID Year Title
19296525 2009 Differential regulation of human thymosin beta 15 isoforms by transforming growth factor beta 1.
17567946 2007 Thymosin beta-NB is the human isoform of rat thymosin beta15.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.