Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.9e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 7.9e-07

Synonym

Accession P0CE67
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MHVCDLQKLVRIQLAFTTFPWMFSCHLLPTPELSSKRNQCLLYKTSGCLTQMPILYGHPATLLKDYILQA      1 - 70
ILQPGKKIQGGTEIQRGSFANQYQTDASHL                                             71 - 100
//

Text Mined References (1)

PMID Year Title