Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.91077389584954E-7


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000


Accession P0CE67


 Compartment GO Term (0)

AA Sequence

ILQPGKKIQGGTEIQRGSFANQYQTDASHL                                             71 - 100

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.