Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P0CAT3
Symbols TD1
TDI
APT-B7

Gene

 Compartment GO Term (1)

AA Sequence

MAPLQLLHPWGRRGAWASQHSLLSQEAMGPGEGAEPTPWGYLRAEHWGASPSGAPTLPFAPDECSLTPGS      1 - 70
PPHPLNKQKHHPPHPSQTQKDLVPRSPQLEKSRIRLRRTLRNLGGGRGQRGQ                       71 - 122
//

Text Mined References (4)

PMID Year Title