Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0CAT3
Symbols TD1
TDI
APT-B7

Gene

 Compartment GO Term (1)

AA Sequence

MAPLQLLHPWGRRGAWASQHSLLSQEAMGPGEGAEPTPWGYLRAEHWGASPSGAPTLPFAPDECSLTPGS      1 - 70
PPHPLNKQKHHPPHPSQTQKDLVPRSPQLEKSRIRLRRTLRNLGGGRGQRGQ                       71 - 122
//

Text Mined References (4)

PMID Year Title
17303350 2007 A promoter with bidirectional activity is located between TLX1/HOX11 and a divergently transcribed novel human gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.