Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.55
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
22402205 PATE proteins are involved in sperm-oolemma fusion and penetration but not sperm-zona binding.
18387948 analysis of PATE, expressed primarily in prostate and less in testis, and additional PATE-like genes PATE-M, PATE-DJ, and PATE-B

AA Sequence

MRKMNTLLLVSLSFLYLKEVMGLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCK      1 - 70
YKCREEESSKRGLLRVTLCCDRNFCNVF                                               71 - 98
//

Text Mined References (5)

PMID Year Title
22402205 2012 Involvement of the prostate and testis expression (PATE)-like proteins in sperm-oocyte interaction.
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
18387948 2008 PATE gene clusters code for multiple, secreted TFP/Ly-6/uPAR proteins that are expressed in reproductive and neuron-rich tissues and possess neuromodulatory activity.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.