Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.55
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C8F1
Symbols PATE-B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRKMNTLLLVSLSFLYLKEVMGLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCK      1 - 70
YKCREEESSKRGLLRVTLCCDRNFCNVF                                               71 - 98
//

Text Mined References (5)

PMID Year Title