Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.33451804465518E-17
medulloblastoma, large-cell 6234 4.52029050874901E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.85319618495773E-4
invasive ductal carcinoma 2950 0.001550044638444

Gene RIF (1)

18187620 Knockdown of UPF0638 protein B (LOC375190) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

SWSGYKHGLLQPQPPGLKRSSRLSFLSGWDCGCLPPCPADF                                 281 - 321

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.