Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MKNVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNA      1 - 70
RRKEMLYKRWVDCVADPLQKKIIEKVCSHKKIKKRRQGELDGFLKHVNKKGNAFIEHYDPKEYDPFYMSK     71 - 140
KDPNFLKVTIPPFHDPLKKAQYDKDNEKRTLLQCETGKIYSIKEFKEVEKVQLHSRFPQISNSRHFITPN    141 - 210
EWLKLPTRYIESEFCRRRRNKGSSFLEREPLCYQEGNNPSAKEAISEGYFSSLSLSRNGRKTRMGLVLSP    211 - 280
SWSGYKHGLLQPQPPGLKRSSRLSFLSGWDCGCLPPCPADF                                 281 - 321
//

Text Mined References (6)

PMID Year Title