Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C864 A0A024RD90
Symbols AGU2
ANCR
SNHG13
KIAA0114
lncRNA-ANCR

Gene

Gene RIF (4)

PMID Text
26514989 Sox4 enhances chondrogenic differentiation and proliferation of human synovium-derived stem cell via activation of long noncoding RNA DANCR
25660720 Significant upregulation of long non-coding RNA-DANCR in circulating monocytes in the postmenopausal osteoporosis patients.
23438432 These data suggest that ANCR is an essential mediator of osteoblast differentiation.
22302877 ANCR lncRNA is thus required to enforce the undifferentiated cell state within epidermis

AA Sequence

MAGPVPPHPGLAVRAAALHPAPLRIFPGLAELPDLSRGSAARPALAQSLPGIGCGPRDPPASLPAPRRLS      1 - 70
GLCARRRSQASLSAGVARADAPLCSGFRAGHACGTGTQPQPTLSSRSSSLTSAEVQLPQFLAQVDNYRHK     71 - 140
PLKLECPVAGISIDLSQLSLQLQ                                                   141 - 163
//

Text Mined References (11)

PMID Year Title
26514989 2015 Sox4 enhances chondrogenic differentiation and proliferation of human synovium-derived stem cell via activation of long noncoding RNA DANCR.
25964079 2016 Long noncoding RNA DANCR increases stemness features of hepatocellular carcinoma by derepression of CTNNB1.
25805135 2015 A LncRNA-MAF:MAFB transcription factor network regulates epidermal differentiation.
25660720 2015 Long non-coding RNA-DANCR in human circulating monocytes: a potential biomarker associated with postmenopausal osteoporosis.
23438432 2013 Downregulated LncRNA-ANCR promotes osteoblast differentiation by targeting EZH2 and regulating Runx2 expression.
22302877 2012 Suppression of progenitor differentiation requires the long noncoding RNA ANCR.
19531736 2009 Transcripts of unknown function in multiple-signaling pathways involved in human stem cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
More...