Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C864 A0A024RD90
Symbols AGU2
ANCR
SNHG13
KIAA0114
lncRNA-ANCR

Gene

 Compartment GO Term (0)

Gene RIF (11)

AA Sequence

MAGPVPPHPGLAVRAAALHPAPLRIFPGLAELPDLSRGSAARPALAQSLPGIGCGPRDPPASLPAPRRLS      1 - 70
GLCARRRSQASLSAGVARADAPLCSGFRAGHACGTGTQPQPTLSSRSSSLTSAEVQLPQFLAQVDNYRHK     71 - 140
PLKLECPVAGISIDLSQLSLQLQ                                                   141 - 163
//

Text Mined References (25)

PMID Year Title