Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.1e-19

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 2.1e-19

Synonym

Accession P0C853
Symbols BAALCOS
C8orf56

 Compartment GO Term (1)

AA Sequence

MSLKSWHPQSKTKRVGASEGNPQWGSGSMEAPLLSSFLPPLASEAELTGNTWFLHRCSCILNLEESMDSD      1 - 70
WGAWWGVSLPRRAPFLIYGSDGPWCTQAGFPGWGH                                        71 - 105
//

Text Mined References (3)

PMID Year Title