Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession P0C853
Symbols BAALCOS
C8orf56

Gene

 Compartment GO Term (1)

AA Sequence

MSLKSWHPQSKTKRVGASEGNPQWGSGSMEAPLLSSFLPPLASEAELTGNTWFLHRCSCILNLEESMDSD      1 - 70
WGAWWGVSLPRRAPFLIYGSDGPWCTQAGFPGWGH                                        71 - 105
//

Text Mined References (3)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.