Property Summary

NCBI Gene PubMed Count 3
PubMed Score 52.53
PubTator Score 18.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.8e-09
psoriasis 6694 1.5e-08
ependymoma 4679 4.2e-08
osteosarcoma 7950 5.5e-04
diabetes mellitus 1728 1.1e-03
sonic hedgehog group medulloblastoma 467 1.2e-02
Disease Target Count Z-score Confidence
Anus cancer 6 3.779 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03
ependymoma 3.100 4.2e-08
osteosarcoma 1.123 5.5e-04
ovarian cancer 1.100 2.8e-09
psoriasis -1.500 1.5e-08
sonic hedgehog group medulloblastoma 2.200 1.2e-02

AA Sequence

MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGV      1 - 70
VITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQKSNFLRSLKSFFLTR        71 - 137
//

Text Mined References (4)

PMID Year Title