Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.1e-05

Expression

Synonym

Accession P0C843
Symbols C9orf14
NCRNA00032

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MHLHVQPLRAKGKRPKDTFNKMAHRKRHSVTSEFLSKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKAKI      1 - 70
EKKAIYERCSRRNMYVNIAVNYLKKLRDQGA                                            71 - 101
//

Text Mined References (1)

PMID Year Title