Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

Synonym

Accession P0C843
Symbols C9orf14
NCRNA00032

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
17099875 C9orf14 is a candidate tumor-suppressor for nevus development and late stage melanoma at 9p21, a region frequently deleted in different types of human cancers.

AA Sequence

MHLHVQPLRAKGKRPKDTFNKMAHRKRHSVTSEFLSKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKAKI      1 - 70
EKKAIYERCSRRNMYVNIAVNYLKKLRDQGA                                            71 - 101
//

Text Mined References (1)

PMID Year Title
17099875 2007 Molecular characterization of a t(9;12)(p21;q13) balanced chromosome translocation in combination with integrative genomics analysis identifies C9orf14 as a candidate tumor-suppressor.