Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.05443130816984E-5



Accession P0C843
Symbols C9orf14


 Compartment GO Term (0)

Gene RIF (1)

17099875 C9orf14 is a candidate tumor-suppressor for nevus development and late stage melanoma at 9p21, a region frequently deleted in different types of human cancers.

AA Sequence

EKKAIYERCSRRNMYVNIAVNYLKKLRDQGA                                            71 - 101

Text Mined References (1)

PMID Year Title
17099875 2007 Molecular characterization of a t(9;12)(p21;q13) balanced chromosome translocation in combination with integrative genomics analysis identifies C9orf14 as a candidate tumor-suppressor.